Anti-Beta Tubulin/TUBB Antibody Picoband®

TUBB antibody

Boster Bio Anti-Beta Tubulin/TUBB Antibody Picoband® catalog # A01857-1. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Monkey, Mouse, Rat, Chicken. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 33 publication(s). Independently reviewed in 1 review(s).

Product Info Summary

SKU: A01857-1
Size: 100 μg/vial
Reactive Species: Chicken, Human, Monkey, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IF, IHC, ICC, WB

Customers Who Bought This Also Bought

Product Name

Anti-Beta Tubulin/TUBB Antibody Picoband®

View all TUBB Antibodies

SKU/Catalog Number

A01857-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Beta Tubulin/TUBB Antibody Picoband® catalog # A01857-1. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Monkey, Mouse, Rat, Chicken. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Beta Tubulin/TUBB Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01857-1)

Host

Rabbit

Contents

Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human Beta Tubulin, identical to the related mouse and rat sequences.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

A01857-1 is reactive to TUBB in Chicken, Human, Monkey, Mouse, Rat

Observed Molecular Weight

50 kDa

Calculated molecular weight

49.7 kDa

Background of TUBB

Tubulin beta chain is a protein that in humans is encoded by the TUBB gene. This gene encodes a beta tubulin protein. This protein forms a dimer with alpha tubulin and acts as a structural component of microtubules. Mutations in this gene cause cortical dysplasia, complex, with other brain malformations 6. Alternative splicing results in multiple splice variants. There are multiple pseudogenes for this gene on chromosomes 1, 6, 7, 8, 9, and 13.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A01857-1 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee

Recommend Dilution

ApplicationDilutionSpecies
Western blot0.1-0.5μg/mlHuman, Monkey, Mouse, Rat, Chicken
Immunohistochemistry (Paraffin-embedded Section)2-5μg/mlHuman
Immunocytochemistry/Immunofluorescence5μg/mlHuman
Flow Cytometry(Fixed)1-3μg/1x106 cellsHuman

Tested application

Beta antibody was positively detected by WB in:
human SiHa whole cell, human 293T whole cell, human HepG2 whole cell, monkey COS-7 whole cell, chicken heart tissue, rat brain tissue, rat PC-12 whole cell, mouse brain tissue, mouse NIH/3T3 whole cell
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane
Beta antibody was positively detected by IHC in:
human liver cancer tissue, human testicular germ cell tumor tissue
Use TE buffer pH 9.0 for antigen retrieval; (*) citrate buffer pH 6.0 is an alternative.
Beta antibody was positively detected by IF in:
U20S cell
Beta antibody was positively detected by FC in:
SiHa cell

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-Beta Tubulin/TUBB Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

1 Reviews For Anti-Beta Tubulin/TUBB Antibody Picoband®

In WB using β-tubulin antibody (Cat# A01857-1), a clear, specific band was observed in OCI-LY8 cells with clean background, showing stable expression after SRPK1 knockdown.

Excellent

SKU A01857-1
Application Western Blot
Sample human OCI-LY1 cells
Sample Processing Description Cell samples were lysed by sonication in RIPA buffer containing protease and phosphatase inhibitors, followed by centrifugation for 10 minutes. The supernatant was mixed with loading buffer at a 4:1 ratio and boiled for 10 minutes. Fifteen microliters of each sample were loaded per well.
Other Reagents 5% Non-fat milk
Primary Antibody Beta Tubulin/TUBB Antibody
Primary Incubation 1:3000, overnight at 4 ℃
Secondary Antibody HRP-conjugated Anti-Rabbit IgG Secondary Antibody
Secondary Incubation 1 hour in room temperature
Detection Substrate: ECL luminescent reagent, Imaging system:ChemiDoc MP
Results Summary The antibody is highly specific and efficient, with a clean background and no nonspecific bands. The target band has clear and well-defined edges.

Verified customer

Submitted

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

7 Customer Q&As for Anti-Beta Tubulin/TUBB Antibody Picoband®

Question

Is this A01857-1 anti-Beta Tubulin/TUBB antibody reactive to the isotypes of TUBB?

Verified Customer

Verified customer

Asked: 2020-04-06

Answer

The immunogen of A01857-1 anti-Beta Tubulin/TUBB antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human Beta Tubulin (383-412aa EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-04-06

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for lung using anti-Beta Tubulin/TUBB antibody A01857-1. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-12-31

Answer

Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-12-31

Question

Is a blocking peptide available for product anti-Beta Tubulin/TUBB antibody (A01857-1)?

Verified Customer

Verified customer

Asked: 2019-12-09

Answer

We do provide the blocking peptide for product anti-Beta Tubulin/TUBB antibody (A01857-1). If you would like to place an order for it please contact support@bosterbio.com and make a special request.

Boster Scientific Support

Answered: 2019-12-09

Question

Would anti-Beta Tubulin/TUBB antibody A01857-1 work for WB with lung?

Verified Customer

Verified customer

Asked: 2019-09-19

Answer

According to the expression profile of lung, TUBB is highly expressed in lung. So, it is likely that anti-Beta Tubulin/TUBB antibody A01857-1 will work for WB with lung.

Boster Scientific Support

Answered: 2019-09-19

Question

I have attached the WB image, lot number and protocol we used for lung using anti-Beta Tubulin/TUBB antibody A01857-1. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-09-12

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-09-12

Question

I have a question about product A01857-1, anti-Beta Tubulin/TUBB antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-08-12

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A01857-1 anti-Beta Tubulin/TUBB antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-08-12

Question

Would A01857-1 anti-Beta Tubulin/TUBB antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

A. Carter

Verified customer

Asked: 2014-02-24

Answer

You can see on the product datasheet, A01857-1 anti-Beta Tubulin/TUBB antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2014-02-24

Order DetailsPrice
A01857-1

100μg

$370
A01857-1-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
A01857-1-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
A01857-1-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
A01857-1-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
A01857-1-APC

100 μg APC conjugated (liquid)

$820
A01857-1-FITC

100 μg FITC conjugated (liquid)

$570
A01857-1-Cy3

100 μg Cy3 conjugated (liquid)

$570
A01857-1-Biotin

100 μg Biotin conjugated (liquid)

$570
A01857-1-HRP

100 μg HRP conjugated (liquid)

$570
A01857-1-PE

100 μg PE conjugated (liquid)

$820
A01857-1-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
A01857-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: May 1, 2026