Anti-C Reactive Protein/CRP Antibody Picoband™

C-Reactive Protein/CRP antibody

Boster Bio Anti-C Reactive Protein/CRP Antibody Picoband™ catalog # A00249-4. Tested in IHC, WB applications. This antibody reacts with Human, Mouse. Cited in 1 publication(s).

Product Info Summary

SKU: A00249-4
Size: 100 μg/vial
Reactive Species: Human, Mouse
Host: Rabbit
Application: IHC, WB

Customers Who Bought This Also Bought

Product Name

Anti-C Reactive Protein/CRP Antibody Picoband™

View all C-Reactive Protein/CRP Antibodies

SKU/Catalog Number



100 μg/vial




Boster Bio Anti-C Reactive Protein/CRP Antibody Picoband™ catalog # A00249-4. Tested in IHC, WB applications. This antibody reacts with Human, Mouse.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-C Reactive Protein/CRP Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00249-4)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




Rabbit IgG


A synthetic peptide corresponding to a sequence of human C Reactive Protein (QTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.


No cross-reactivity with other proteins.

Reactive Species

A00249-4 is reactive to CRP in Human, Mouse


A00249-4 is guaranteed for IHC, WB Boster Guarantee

Background of C-Reactive Protein/CRP

C Reactive Protein (CRP) is a major acute phase reactant synthesized primarily in the liver hepatocytes. It is composed of 5 identical, 21,500-molecular weight subunits. CRP mediates activities associated with preimmune nonspecific host resistance. CRP shows the strongest association with cardiovascular events. It is detectable on the surface of about 4% of normal peripheral blood lymphocytes. Acute phase reactant CRP is produced in the liver.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml

Validation Images & Assay Conditions

Gene/Protein Information For CRP (Source:, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

C-reactive protein




pentraxin family

Alternative Names

C-Reactive Protein; C-reactive protein, pentraxin-related; CRP; MGC88244; pentraxin 1; PTX1MGC149895 CRP PTX1 C-reactive protein C-reactive protein|C-reactive protein, pentraxin-related|pentraxin 1

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on CRP, check out the CRP Infographic

CRP infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CRP: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected]

A00249-4 has been cited in 1 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Protective effects of potential probiotic Lactobacillus rhamnosus (MTCC-5897) fermented whey on reinforcement of intestinal epithelial barrier function in a colitis-induced murine model

Have you used Anti-C Reactive Protein/CRP Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-C Reactive Protein/CRP Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

16 Customer Q&As for Anti-C Reactive Protein/CRP Antibody Picoband™


Is a blocking peptide available for product anti-C Reactive Protein/CRP antibody (A00249-4)?

Verified Customer

Verified customer

Asked: 2020-02-21


We do provide the blocking peptide for product anti-C Reactive Protein/CRP antibody (A00249-4). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2020-02-21


My team were satisfied with the WB result of your anti-C Reactive Protein/CRP antibody. However we have seen positive staining in right lobe of liver secreted. using this antibody. Is that expected? Could you tell me where is CRP supposed to be expressed?

Verified Customer

Verified customer

Asked: 2020-02-07


According to literature, right lobe of liver does express CRP. Generally CRP expresses in secreted. Regarding which tissues have CRP expression, here are a few articles citing expression in various tissues:
Liver, Pubmed ID: 15489334
Urinary bladder, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2020-02-07


Is this A00249-4 anti-C Reactive Protein/CRP antibody reactive to the isotypes of CRP?

Verified Customer

Verified customer

Asked: 2019-12-06


The immunogen of A00249-4 anti-C Reactive Protein/CRP antibody is A synthetic peptide corresponding to a sequence of human C Reactive Protein (QTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-12-06


My lab would like to test anti-C Reactive Protein/CRP antibody A00249-4 on mouse liver for research purposes, then I may be interested in using anti-C Reactive Protein/CRP antibody A00249-4 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-07-29


The products we sell, including anti-C Reactive Protein/CRP antibody A00249-4, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-07-29


I was wanting to use your anti-C Reactive Protein/CRP antibody for WB for mouse liver on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for mouse liver identification?

G. Kulkarni

Verified customer

Asked: 2019-06-03


As indicated on the product datasheet, A00249-4 anti-C Reactive Protein/CRP antibody has been validated for IHC, WB on human, mouse tissues. We have an innovator award program that if you test this antibody and show it works in mouse liver in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-06-03


Will A00249-4 anti-C Reactive Protein/CRP antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2019-05-28


It shows on the product datasheet, A00249-4 anti-C Reactive Protein/CRP antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-05-28


We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for liver using anti-C Reactive Protein/CRP antibody A00249-4. Let me know if you need anything else.

B. Krishna

Verified customer

Asked: 2019-05-24


Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-05-24


We have observed staining in mouse liver. Are there any suggestions? Is anti-C Reactive Protein/CRP antibody supposed to stain liver positively?

G. Parker

Verified customer

Asked: 2018-03-07


According to literature liver does express CRP. According to, CRP is expressed in right lobe of liver, liver, urinary bladder, among other tissues. Regarding which tissues have CRP expression, here are a few articles citing expression in various tissues:
Liver, Pubmed ID: 15489334
Urinary bladder, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2018-03-07


My lab would like using your anti-C Reactive Protein/CRP antibody for defense response to gram-positive bacterium studies. Has this antibody been tested with western blotting on small intestine tissue? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2017-05-15


Thanks for your inquiry. This A00249-4 anti-C Reactive Protein/CRP antibody is tested on human a431 whole cell lysate, rat liver tissue, liver cancer tissue, mouse liver tissue, small intestine tissue. It is guaranteed to work for IHC, WB in human, mouse. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2017-05-15


Our lab used your anti-C Reactive Protein/CRP antibody for WB on urinary bladder in the past. I am using mouse, and We intend to use the antibody for IHC next. I am interested in examining urinary bladder as well as liver in our next experiment. Could you please give me some suggestion on which antibody would work the best for IHC?

E. Mangal

Verified customer

Asked: 2017-02-23


I looked at the website and datasheets of our anti-C Reactive Protein/CRP antibody and it appears that A00249-4 has been validated on mouse in both WB and IHC. Thus A00249-4 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC in mouse even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC detection and you can check out our website to find out more information about them.

Boster Scientific Support

Answered: 2017-02-23


Please see the WB image, lot number and protocol we used for liver using anti-C Reactive Protein/CRP antibody A00249-4. Please let me know if you require anything else.

J. Mitchell

Verified customer

Asked: 2016-08-15


Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2016-08-15


We are currently using anti-C Reactive Protein/CRP antibody A00249-4 for mouse tissue, and we are happy with the IHC results. The species of reactivity given in the datasheet says human, mouse. Is it true that the antibody can work on pig tissues as well?

W. Lewis

Verified customer

Asked: 2016-06-06


The anti-C Reactive Protein/CRP antibody (A00249-4) has not been tested for cross reactivity specifically with pig tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2016-06-06


I see that the anti-C Reactive Protein/CRP antibody A00249-4 works with WB, what is the protocol used to produce the result images on the product page?

A. Zhao

Verified customer

Asked: 2016-04-04


You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2016-04-04


Would anti-C Reactive Protein/CRP antibody A00249-4 work for WB with liver?

E. Anderson

Verified customer

Asked: 2015-05-28


According to the expression profile of liver, CRP is highly expressed in liver. So, it is likely that anti-C Reactive Protein/CRP antibody A00249-4 will work for WB with liver.

Boster Scientific Support

Answered: 2015-05-28


Do you have a BSA free version of anti-C Reactive Protein/CRP antibody A00249-4 available?

P. Lewis

Verified customer

Asked: 2014-11-12


I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-C Reactive Protein/CRP antibody A00249-4 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2014-11-12


My question regarding product A00249-4, anti-C Reactive Protein/CRP antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

H. Johnson

Verified customer

Asked: 2014-03-21


We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00249-4 anti-C Reactive Protein/CRP antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2014-03-21



Total: $315


Ask a question

Get A Quote

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.