Anti-CD105/ENG Antibody Picoband™

Boster Bio Anti-CD105/ENG Antibody Picoband™ catalog # A02997-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. Cited in 10 publication(s).

Product Info Summary

SKU: A02997-1
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Product Name

Anti-CD105/ENG Antibody Picoband™

See all Endoglin/CD105 products

SKU/Catalog Number

A02997-1

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-CD105/ENG Antibody Picoband™ catalog # A02997-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-CD105/ENG Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A02997-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human CD105 (258-297aa YVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQ), different from the related mouse sequence by twelve amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A02997-1 is reactive to ENG in Human, Mouse, Rat

Applications

A02997-1 is guaranteed for WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat

Validation Images & Assay Conditions

Gene/Protein Information For ENG (Source: Uniprot.Org, NCBI)

Uniprot ID

P17813

Gene ID

2022

Gene Name

ENG

Full Name

Endoglin

Weight

70.578kDa

Alternative Names

CD105 antigen; CD105; Endoglin; ENDOsler-Rendu-Weber syndrome 1; ENG; HHT1FLJ41744; ORW; ORW1 ENG END, HHT1, ORW1 endoglin endoglin|CD105 antigen

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on ENG, check out the ENG Infographic

ENG infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for ENG: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

A02997-1 has been cited in 10 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Wu,H.,Jiang,X.,Li,Y.,Zhou,Y.,Zhang,T.,Zhi,P.,Gao,J.,Engineering Stem Cell Derived Biomimetic Vesicles for Versatility and Effective Targeted Delivery.Adv. Funct.Mater.2020, 30, 2006169.https://doi.org/10.1002/adfm.202006169
Species: Rat,Mouse

VEGF promotes cartilage angiogenesis by phospho-ERK1/2 activation of Dll4 signaling in temporomandibular joint osteoarthritis caused by chronic sleep %u2026

Effects of human umbilical cord mesenchymal stem cell transplantation combined with minimally invasive hematoma aspiration on intracerebral hemorrhage in rats.

Administration of BMSCs with Muscone in Rats with Gentamicin-Induced AKI Improves Their Therapeutic Efficacy

Overexpression of transcription factor Foxa2 and Hnf1? induced rat bone mesenchymal stem cells into hepatocytes

Effects of BMSCs interactions with adventitial fibroblasts in transdifferentiation and ultrastructure processes

Antitumor activity of endogenous mFlt4 displayed on a T4 phage nanoparticle surface

Ren Sx, Ren Zj, Zhao My, Wang Xb, Zuo Sg, Yu F. Acta Pharmacol Sin. 2009 May;30(5):637-45. Doi: 10.1038/Aps.2009.44. Antitumor Activity Of Endogenous Mflt4 Displayed On A T4 Phage Nanoparticle Surface.

Li J, Zeng G, Qi Y, Tang X, Zhang J, Wu Z, Liang J, Shi L, Liu H, Zhang P. Plos One. 2015 Apr 7;10(4):E0123264. Doi: 10.1371/Journal.Pone.0123264. Ecollection 2015. Xenotransplantation Of Human Adipose-Derived Stem Cells In Zebrafish Embryos.

Dai J, Li Y, Zhou H, Chen J, Chen M, Xiao Z. Int J Biol Sci. 2013 Nov 21;9(10):1089-98. Doi: 10.7150/Ijbs.7367. Ecollection 2013. Genistein Promotion Of Osteogenic Differentiation Through Bmp2/Smad5/Runx2 Signaling.

Have you used Anti-CD105/ENG Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-CD105/ENG Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Anti-CD105/ENG Antibody Picoband™

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
A02997-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$240.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.