Anti-CD36 Antibody Picoband™

Boster Bio Anti-CD36 Antibody Picoband™ catalog # PB9371. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. Cited in 2 publication(s).

Product Info Summary

SKU: PB9371
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Product Name

Anti-CD36 Antibody Picoband™

See all CD36/SR-B3 products

SKU/Catalog Number

PB9371

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-CD36 Antibody Picoband™ catalog # PB9371. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-CD36 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9371)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human CD36 (31-66aa DLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFW), different from the related mouse sequence by six amino acids, and from the related rat sequence by four amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

PB9371 is reactive to CD36 in Human, Mouse, Rat

Applications

PB9371 is guaranteed for IHC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Rat, By Heat
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat

Validation Images & Assay Conditions

Gene/Protein Information For CD36 (Source: Uniprot.Org, NCBI)

Uniprot ID

P16671

Gene ID

948

Gene Name

CD36

Full Name

Platelet glycoprotein 4

Weight

53.053kDa

Superfamily

CD36 family

Alternative Names

CD36 antigen; CD36 molecule (thrombospondin receptor); CD36; Collagen R; FA6-152; FAT; FATCHDS7; Fatty acid translocase; Glycoprotein IIIb; GP3Bthrombospondin receptor); GPIIIb; GPIV; Leukocyte differentiation antigen CD36; PAS IV; PAS-4; Platelet collagen receptor; platelet glycoprotein 4; Platelet glycoprotein IV; SCARB3; scavenger receptor class B, member 3; SRB3; SR-B3; Thrombospondin R; Thrombospondin receptor CD36 BDPLT10, CHDS7, FAT, GP3B, GP4, GPIV, PASIV, SCARB3 CD36 molecule platelet glycoprotein 4|CD36 antigen (collagen type I receptor, thrombospondin receptor)|CD36 molecule (thrombospondin receptor)|GPIIIB|PAS IV|PAS-4 protein|cluster determinant 36|fatty acid translocase|glycoprotein IIIb|leukocyte differentiation antigen CD36|platelet glycoprotein IV|scavenger receptor class B, member 3

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on CD36, check out the CD36 Infographic

CD36 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for CD36: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

PB9371 has been cited in 2 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Huang Y,Zhao C,Kong Y,Tan P,Liu S,Liu Y,Zeng F,Yuan Y,Zhao B,Wang J.Elucidation of the mechanism of NEFA-induced PERK-eIF2α signaling pathway regulation of lipid metabolism in bovine hepatocytes.J Steroid Biochem Mol Biol.2021 Apr 2:105893.doi:10.101 6/j.jsbmb.2021.105893.Epub ahead of print.PMID:33819629.
Species: Holstein calves
PB9371 usage in article: APP:WB, SAMPLE:HEPATOCYTES, DILUTION:1:1000

Kong Y, Zhao C, Huang Y, Liu Y, Liu S, Guo Y, Li M, Xu T, Zhao B, Wang J. Angiopoietin-like protein 4 promotes very-low-density lipoprotein assembly and secretion in bovine hepatocytes in vitro. IUBMB Life. 2020 Nov 17. doi: 10.1002/iub.2403. Epub ahead o
Species: Calf
PB9371 usage in article: APP:WB, SAMPLE:HEPATOCYTES, DILUTION:NA

Have you used Anti-CD36 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-CD36 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

8 Customer Q&As for Anti-CD36 Antibody Picoband™

Question

I would like to know about the Anti-CD36 Antibody Picoband, how long would the cells be treated for the blocking study?

Verified Customer

Verified customer

Asked: 2020-04-14

Answer

We would recommend for the Anti-CD36 Antibody Picoband concentration is 2ug/ml, however the incubation time will need to be determined by the investigator depending on the biomarkers they are measuring.

Boster Scientific Support

Answered: 2020-04-14

Question

We were well pleased with the WB result of your anti-CD36 antibody. However we have been able to see positive staining in skeletal muscle cell membrane using this antibody. Is that expected? Could you tell me where is CD36 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2020-03-18

Answer

From literature, skeletal muscle does express CD36. Generally CD36 expresses in cell membrane. Regarding which tissues have CD36 expression, here are a few articles citing expression in various tissues:
Adipocyte, Pubmed ID: 15242332
Liver, Pubmed ID: 19159218
Milk, Pubmed ID: 18780401
Placenta, Pubmed ID: 2473841
Platelet, Pubmed ID: 16263699, 2468669, 11668637, 7505064, 7518447, 12853948
Skeletal muscle, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2020-03-18

Question

I am interested in using your anti-CD36 antibody for sensory perception of taste studies. Has this antibody been tested with western blotting on spleen tissue? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2020-03-09

Answer

We appreciate your inquiry. This PB9371 anti-CD36 antibody is validated on rat liver tissue, tissue lysate, cardiac muscle tissue, mouse liver tissue, smmc whole cell lysate, spleen tissue. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2020-03-09

Question

We are currently using anti-CD36 antibody PB9371 for rat tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on pig tissues as well?

Verified Customer

Verified customer

Asked: 2019-09-30

Answer

The anti-CD36 antibody (PB9371) has not been validated for cross reactivity specifically with pig tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-09-30

Question

We have observed staining in human liver. Are there any suggestions? Is anti-CD36 antibody supposed to stain liver positively?

C. Edwards

Verified customer

Asked: 2019-09-02

Answer

Based on literature liver does express CD36. Based on Uniprot.org, CD36 is expressed in adipose tissue, placenta, platelet, skeletal muscle, adipocyte, milk, liver, among other tissues. Regarding which tissues have CD36 expression, here are a few articles citing expression in various tissues:
Adipocyte, Pubmed ID: 15242332
Liver, Pubmed ID: 19159218
Milk, Pubmed ID: 18780401
Placenta, Pubmed ID: 2473841
Platelet, Pubmed ID: 16263699, 2468669, 11668637, 7505064, 7518447, 12853948
Skeletal muscle, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2019-09-02

Question

We purchased anti-CD36 antibody for WB on skeletal muscle a few years ago. I am using human, and I plan to use the antibody for IHC next. I would like examining skeletal muscle as well as milk in our next experiment. Could you please give me some suggestion on which antibody would work the best for IHC?

Verified Customer

Verified customer

Asked: 2019-06-26

Answer

I took a look at the website and datasheets of our anti-CD36 antibody and I see that PB9371 has been tested on human in both WB and IHC. Thus PB9371 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2019-06-26

Question

I would like to know what the antigen recognition site for this antibody PB9371, is it in the amino acid peptide sequence of CD36? Or peptide modified by glycosylation

Verified Customer

Verified customer

Asked: 2016-06-16

Answer

The immunogen for antibody PB9371 is 20 weeks old fetal erythrocytes and we have not further mapped the epitope for this antibody.

Boster Scientific Support

Answered: 2016-06-16

Question

How long is this PB9371 antibody stable at 4 degrees?

Verified Customer

Verified customer

Asked: 2013-06-25

Answer

The product PB9371 antibody must be stored at 4degrees under recommended conditions and this product would be stable for one year from the date of receipt.

Boster Scientific Support

Answered: 2013-06-25

Conjugation

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
PB9371
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$280.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.