Anti-FH Antibody Picoband™ (monoclonal, 9D8)

Boster Bio Anti-FH Antibody Picoband™ (monoclonal, 9D8) catalog # M02097. Tested in IF, IHC-P, ICC, WB applications. This antibody reacts with Human, Monkey, Mouse, Rat.

Product Info Summary

SKU: M02097
Size: 100μg/vial
Reactive Species: Human, Monkey, Mouse, Rat
Host: Mouse
Application: IF, IHC-P, ICC, WB

Product Name

Anti-FH Antibody Picoband™ (monoclonal, 9D8)

See all Fumarase products

SKU/Catalog Number







Boster Bio Anti-FH Antibody Picoband™ (monoclonal, 9D8) catalog # M02097. Tested in IF, IHC-P, ICC, WB applications. This antibody reacts with Human, Monkey, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-FH Antibody Picoband™ (monoclonal, 9D8) (Boster Biological Technology, Pleasanton CA, USA, Catalog # M02097)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.



Clone Number





A synthetic peptide corresponding to a sequence of human FH (YDKAAKIAKTAH KNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

M02097 is reactive to FH in Human, Monkey, Mouse, Rat


M02097 is guaranteed for IF, IHC-P, ICC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Immunocytochemistry/Immunofluorescence, 5 μg/ml

Validation Images & Assay Conditions

Gene/Protein Information For FH (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Fumarate hydratase, mitochondrial




class-II fumarase/aspartase family

Alternative Names

EC; fumarase; fumarate hydratase; fumarate hydratase, mitochondrial; HLRCC; LRCC; MCL; MCUL1 FH FMRD, HLRCC, HsFH, LRCC, MCL, MCUL1 fumarate hydratase fumarate hydratase, mitochondrial|epididymis secretory sperm binding protein|fumarase

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on FH, check out the FH Infographic

FH infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for FH: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for M02097

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-FH Antibody Picoband™ (monoclonal, 9D8)?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-FH Antibody Picoband™ (monoclonal, 9D8)

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

3 Customer Q&As for Anti-FH Antibody Picoband™ (monoclonal, 9D8)


Does anti-FH antibody (monoclonal, 9D8) M02097 work for IHC with liver?

Verified Customer

Verified customer

Asked: 2019-12-06


According to the expression profile of liver, FH is highly expressed in liver. So, it is likely that anti-FH antibody (monoclonal, 9D8) M02097 will work for IHC with liver.

Boster Scientific Support

Answered: 2019-12-06


We are currently using anti-FH antibody (monoclonal, 9D8) M02097 for rat tissue, and we are happy with the IHC results. The species of reactivity given in the datasheet says human, monkey, mouse, rat. Is it possible that the antibody can work on primate tissues as well?

Verified Customer

Verified customer

Asked: 2017-09-15


The anti-FH antibody (monoclonal, 9D8) (M02097) has not been tested for cross reactivity specifically with primate tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2017-09-15


I was wanting to use your anti-FH antibody (monoclonal, 9D8) for IHC for mouse liver on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for mouse liver identification?

M. Taylor

Verified customer

Asked: 2013-05-06


It shows on the product datasheet, M02097 anti-FH antibody (monoclonal, 9D8) has been validated for IHC, WB on human, monkey, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse liver in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2013-05-06


Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.