Anti-GAPDH Antibody Picoband™

GAPDH antibody

Boster Bio Anti-GAPDH Antibody Picoband™ catalog # A00227. Tested in WB applications. This antibody reacts with Human. Cited in 10 publication(s).

Product Info Summary

SKU: A00227
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: WB

Customers Who Bought This Also Bought

Product Name

Anti-GAPDH Antibody Picoband™

View all GAPDH Antibodies

SKU/Catalog Number

A00227

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-GAPDH Antibody Picoband™ catalog # A00227. Tested in WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-GAPDH Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00227)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human GAPDH (302-335aa ALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE), different from the related mouse and rat sequences by three amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A00227 is reactive to GAPDH in Human

Applications

A00227 is guaranteed for WB Boster Guarantee

Background of GAPDH

Glyceraldehyde 3-phosphate dehydrogenase (abbreviated as GAPDH or less commonly as G3PDH) is an enzyme of ~37kDa that catalyzes the sixth step of glycolysis and thus serves to break down glucose for energy and carbon molecules. This gene encodes a member of the glyceraldehyde-3-phosphate dehydrogenase protein family. GAPDH is mapped to 12p13.31. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. The product of this gene catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The encoded protein has additionally been identified to have uracil DNA glycosylase activity in the nucleus.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human

Validation Images & Assay Conditions

Gene/Protein Information For GAPDH (Source: Uniprot.org, NCBI)

Uniprot ID

P04406

Gene ID

2597

Gene Name

GAPDH

Full Name

Glyceraldehyde-3-phosphate dehydrogenase

Weight

36.053kDa

Superfamily

glyceraldehyde-3-phosphate dehydrogenase family

Alternative Names

1D4 GAPDH; aging-associated gene 9 protein; Cytoplasm Marker; EC 1.2.1; EC 1.2.1.12; EC 2.6.99.-; G3PD; G3PD; G3PDH; GAPD; GAPDH; GAPDPeptidyl-cysteine S-nitrosylase GAPDH; glyceraldehyde 3-phosphate dehydrogenase; glyceraldehyde-3-phosphate dehydrogenase; MGC102544; MGC102546; MGC103190; MGC103191; MGC105239; MGC127711; MGC88685; OCAS, p38; OCT1 coactivator in S phase; Peptidyl-cysteine S-nitrosylase GAPDH GAPDH G3PD, GAPD, HEL-S-162eP glyceraldehyde-3-phosphate dehydrogenase glyceraldehyde-3-phosphate dehydrogenase|OCAS, p38 component|Oct1 coactivator in S phase, 38 Kd component|aging-associated gene 9 protein|epididymis secretory sperm binding protein Li 162eP|peptidyl-cysteine S-nitrosylase GAPDH

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on GAPDH, check out the GAPDH Infographic

GAPDH infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GAPDH: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected]

A00227 has been cited in 10 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

CD38 affects the biological behavior and energy metabolism of nasopharyngeal carcinoma cells

Knockdown of STIP1 inhibits the invasion of CD133‑positive cancer stem‑like cells of the osteosarcoma MG63 cell line via the PI3K/Akt and ERK1/2 pathways

Evodiamine promotes differentiation and inhibits proliferation of C2C12 muscle cells

miR‑210‑3p regulates the proliferation and apoptosis of non‑small cell lung cancer cells by targeting SIN3A

Krill Oil Alleviated Methamphetamine-Induced Memory Impairment via the MAPK Signaling Pathway and Dopaminergic Synapse Pathway

Protective Effect of Dictyophora Polysaccharides on Sodium Arsenite-Induced Hepatotoxicity: A Proteomics Study

A Single Low Dose of Dexmedetomidine Efficiently Attenuates Esketamine-Induced Overactive Behaviors and Neuronal Hyperactivities in Mice

RIPK3-Dependent Necroptosis Is Induced and Restricts Viral Replication in Human Astrocytes Infected With Zika Virus

ZD6474, a Small Molecule Tyrosine Kinase Inhibitor, Potentiates the Anti-Tumor and Anti-Metastasis Effects of Radiation for Human Nasopharyngeal Carcinoma

Hydrogel-hydroxyapatite-monomeric collagen type-I scaffold with low-frequency electromagnetic field treatment enhances osteochondral repair in rabbits

Have you used Anti-GAPDH Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-GAPDH Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

15 Customer Q&As for Anti-GAPDH Antibody Picoband™

Question

Does A00227 anti-GAPDH antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2020-03-06

Answer

It shows on the product datasheet, A00227 anti-GAPDH antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2020-03-06

Question

We are currently using anti-GAPDH antibody A00227 for human tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human. Is it true that the antibody can work on dog tissues as well?

Verified Customer

Verified customer

Asked: 2020-02-14

Answer

The anti-GAPDH antibody (A00227) has not been tested for cross reactivity specifically with dog tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-02-14

Question

I see that the anti-GAPDH antibody A00227 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2020-02-10

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2020-02-10

Question

Our team were content with the WB result of your anti-GAPDH antibody. However we have observed positive staining in cervix carcinoma erythroleukemia cytosol using this antibody. Is that expected? Could you tell me where is GAPDH supposed to be expressed?

Verified Customer

Verified customer

Asked: 2020-02-03

Answer

From literature, cervix carcinoma erythroleukemia does express GAPDH. Generally GAPDH expresses in cytoplasm, cytosol. Regarding which tissues have GAPDH expression, here are a few articles citing expression in various tissues:
Astrocytoma, Pubmed ID: 10944468
Cervix carcinoma, Pubmed ID: 17081983, 18669648, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Heart, Pubmed ID: 7498159
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 2987855, 24275569
Lung, Pubmed ID: 3664468
Lymphoblast, Pubmed ID: 14654843
Muscle, Pubmed ID: 1193541, 11724794
Placenta, Pubmed ID: 1924305

Boster Scientific Support

Answered: 2020-02-03

Question

Is this A00227 anti-GAPDH antibody reactive to the isotypes of GAPDH?

Verified Customer

Verified customer

Asked: 2020-01-29

Answer

The immunogen of A00227 anti-GAPDH antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human GAPDH (302-335aa ALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE), different from the related mouse and rat sequences by three amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-01-29

Question

We need to test anti-GAPDH antibody A00227 on human smooth muscle tissue for research purposes, then I may be interested in using anti-GAPDH antibody A00227 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2020-01-17

Answer

The products we sell, including anti-GAPDH antibody A00227, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2020-01-17

Question

Is there a BSA free version of anti-GAPDH antibody A00227 available?

Verified Customer

Verified customer

Asked: 2019-12-25

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-GAPDH antibody A00227 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-12-25

Question

Is a blocking peptide available for product anti-GAPDH antibody (A00227)?

Verified Customer

Verified customer

Asked: 2019-08-20

Answer

We do provide the blocking peptide for product anti-GAPDH antibody (A00227). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-08-20

Question

We want using your anti-GAPDH antibody for positive regulation of cytokine secretion studies. Has this antibody been tested with western blotting on colo320 whole cell lysates? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2019-07-25

Answer

We appreciate your inquiry. This A00227 anti-GAPDH antibody is tested on colo320 whole cell lysates, a549 whole cell lysates. It is guaranteed to work for WB in human. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2019-07-25

Question

I was wanting to use your anti-GAPDH antibody for WB for human smooth muscle tissue on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human smooth muscle tissue identification?

K. Brown

Verified customer

Asked: 2018-07-23

Answer

As indicated on the product datasheet, A00227 anti-GAPDH antibody has been tested for WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human smooth muscle tissue in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2018-07-23

Question

I have attached the WB image, lot number and protocol we used for smooth muscle tissue using anti-GAPDH antibody A00227. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2017-08-14

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2017-08-14

Question

Does anti-GAPDH antibody A00227 work for WB with smooth muscle tissue?

A. Mangal

Verified customer

Asked: 2016-08-24

Answer

According to the expression profile of smooth muscle tissue, GAPDH is highly expressed in smooth muscle tissue. So, it is likely that anti-GAPDH antibody A00227 will work for WB with smooth muscle tissue.

Boster Scientific Support

Answered: 2016-08-24

Question

Can you help my question with product A00227, anti-GAPDH antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Z. Kulkarni

Verified customer

Asked: 2015-12-16

Answer

We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00227 anti-GAPDH antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2015-12-16

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for smooth muscle tissue using anti-GAPDH antibody A00227. Let me know if you need anything else.

A. Moore

Verified customer

Asked: 2015-01-23

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2015-01-23

Question

We have been able to see staining in human astrocytoma. Are there any suggestions? Is anti-GAPDH antibody supposed to stain astrocytoma positively?

J. Carter

Verified customer

Asked: 2013-09-20

Answer

Based on literature astrocytoma does express GAPDH. Based on Uniprot.org, GAPDH is expressed in smooth muscle tissue, liver, lung, placenta, astrocytoma, leukemia, colon adenocarcinoma, eye, kidney, lung, lymph placenta, muscle, platelet, prostatic carcinoma, brain, cajal-retzius cell fetal brain cortex, heart, lymphoblast, cervix carcinoma, leukemic t-cell, cervix carcinoma erythroleukemia, among other tissues. Regarding which tissues have GAPDH expression, here are a few articles citing expression in various tissues:
Astrocytoma, Pubmed ID: 10944468
Cervix carcinoma, Pubmed ID: 17081983, 18669648, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Heart, Pubmed ID: 7498159
Leukemic T-cell, Pubmed ID: 19690332
Liver, Pubmed ID: 2987855, 24275569
Lung, Pubmed ID: 3664468
Lymphoblast, Pubmed ID: 14654843
Muscle, Pubmed ID: 1193541, 11724794
Placenta, Pubmed ID: 1924305

Boster Scientific Support

Answered: 2013-09-20

Size

Conjugation

Total: $315

SKU:A00227

Ask a question

Get A Quote

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

Product Categories

Primary Antibodies

Primary and Secondary Antibodies

Boster Bio offers over 16,000 antibodies that have been validated for IHC, WB, ELISA, and FC in human, mouse, and rat samples. Rabbit and mouse monoclonal antibodies as well as rabbit polyclonal antibodies are available. Buy a primary antibody and get a secondary antibody for free!

ELISA Kits

ELISA Kits

More than 1,000 ELISA kits, both singleplex and multiplex, that have been cited 6,000+ times are available at Boster. We offer our Boster-branded Picokine™ ELISA kits (sandwich ELISA) and EZ-Set™ ELISA kits (DIY antibody pairs) in addition to many multiplex ELISA kits.

Image

Recombinant Proteins

Boster provides a wide range of human, mouse, and rat recombinant proteins, which include cytokines, growth factors, chemokines, and many more. Our recombinant proteins have high stability, biological activity, and purity.

Boster Kit

Reagents

Boster offers all the reagents you need for your immunostaining and western blotting experiments. We've got everything from buffers to lysates to kits, including our popular and well-cited BCA, CCK-8, and MTT assay kits.

In stock
Order Product
A00227
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$315.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.