Anti-GNAQ Antibody Picoband™ (monoclonal, 13H4)

Boster Bio Anti-GNAQ Antibody Picoband™ (monoclonal, 13H4) catalog # M00898. Tested in Flow Cytometry, IHC-P, WB applications. This antibody reacts with Human, Monkey, Mouse, Rat.

Product Info Summary

SKU: M00898
Size: 100μg/vial
Reactive Species: Human, Monkey, Mouse, Rat
Host: Mouse
Application: Flow Cytometry, IHC-P, WB

Product Name

Anti-GNAQ Antibody Picoband™ (monoclonal, 13H4)

See all GNAQ products

SKU/Catalog Number

M00898

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-GNAQ Antibody Picoband™ (monoclonal, 13H4) catalog # M00898. Tested in Flow Cytometry, IHC-P, WB applications. This antibody reacts with Human, Monkey, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-GNAQ Antibody Picoband™ (monoclonal, 13H4) (Boster Biological Technology, Pleasanton CA, USA, Catalog # M00898)

Host

Mouse

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Monoclonal

Clone Number

13H4

Isotype

IgG2b

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human GNAQ (102-138aa KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND), identical to the related mouse and rat sequences.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

M00898 is reactive to GNAQ in Human, Monkey, Mouse, Rat

Applications

M00898 is guaranteed for Flow Cytometry, IHC-P, WB Boster Guarantee

*Blocking peptide can be purchased at $150. Contact us for more information.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500μg/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Flow Cytometry, 1-3μg/1x106 cells

Validation Images & Assay Conditions

Gene/Protein Information For GNAQ (Source: Uniprot.Org, NCBI)

Uniprot ID

P50148

Gene ID

2776

Gene Name

GNAQ

Full Name

Guanine nucleotide-binding protein G(q) subunit alpha

Weight

42.142kDa

Superfamily

G-alpha family

Alternative Names

GAQG-ALPHA-q; guanine nucleotide binding protein (G protein), q polypeptide; Guanine nucleotide-binding protein alpha-q; guanine nucleotide-binding protein G(q) subunit alpha GNAQ CMC1, G-ALPHA-q, GAQ, SWS G protein subunit alpha q guanine nucleotide-binding protein G(q) subunit alpha|epididymis secretory sperm binding protein|guanine nucleotide binding protein (G protein), q polypeptide|guanine nucleotide-binding protein alpha-q

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on GNAQ, check out the GNAQ Infographic

GNAQ infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for GNAQ: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for M00898

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-GNAQ Antibody Picoband™ (monoclonal, 13H4)?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-GNAQ Antibody Picoband™ (monoclonal, 13H4)

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

6 Customer Q&As for Anti-GNAQ Antibody Picoband™ (monoclonal, 13H4)

Question

Is there a BSA free version of anti-GNAQ antibody (monoclonal, 13H4) M00898 available?

Verified Customer

Verified customer

Asked: 2019-12-16

Answer

I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-GNAQ antibody (monoclonal, 13H4) M00898 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-12-16

Question

I am interested in to test anti-GNAQ antibody (monoclonal, 13H4) M00898 on human thoracic mammary gland for research purposes, then I may be interested in using anti-GNAQ antibody (monoclonal, 13H4) M00898 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

R. Carter

Verified customer

Asked: 2019-11-22

Answer

The products we sell, including anti-GNAQ antibody (monoclonal, 13H4) M00898, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-11-22

Question

I have a question about product M00898, anti-GNAQ antibody (monoclonal, 13H4). I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-05-20

Answer

It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free M00898 anti-GNAQ antibody (monoclonal, 13H4), we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-05-20

Question

I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for thoracic mammary gland using anti-GNAQ antibody (monoclonal, 13H4) M00898. Let me know if you need anything else.

D. Krishna

Verified customer

Asked: 2018-11-27

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-11-27

Question

Is a blocking peptide available for product anti-GNAQ antibody (monoclonal, 13H4) (M00898)?

G. Huang

Verified customer

Asked: 2018-08-07

Answer

We do provide the blocking peptide for product anti-GNAQ antibody (monoclonal, 13H4) (M00898). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2018-08-07

Question

I was wanting to use your anti-GNAQ antibody (monoclonal, 13H4) for Flow Cytometry for human thoracic mammary gland on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human thoracic mammary gland identification?

Verified Customer

Verified customer

Asked: 2017-07-31

Answer

It shows on the product datasheet, M00898 anti-GNAQ antibody (monoclonal, 13H4) has been validated for Flow Cytometry, IHC-P, WB on human, monkey tissues. We have an innovator award program that if you test this antibody and show it works in human thoracic mammary gland in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2017-07-31

$280

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
M00898
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$280.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.