Anti-HCN2 Antibody Picoband™

Boster Bio Anti-HCN2 Antibody Picoband™ catalog # A02804. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A02804
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Product Name

Anti-HCN2 Antibody Picoband™

See all HCN2 products

SKU/Catalog Number







Boster Bio Anti-HCN2 Antibody Picoband™ catalog # A02804. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-HCN2 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A02804)




Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence at the C-terminus of human HCN2 (682-714aa VFNNQENAIIQEIVKYDREMVQQAELGQRVGLF), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A02804 is reactive to HCN2 in Human, Mouse, Rat


A02804 is guaranteed for IHC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Rat, Human, By Heat
Western blot, 0.1-0.5μg/ml, Mouse, Rat, Human

Validation Images & Assay Conditions

Gene/Protein Information For HCN2 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2




potassium channel HCN family

Alternative Names

BCNG2; BCNG-2; brain cyclic nucleotide gated channel 2; brain cyclic nucleotide-gated channel 2; HAC-1; hyperpolarization activated cyclic nucleotide-gated potassium channel 2; potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 HCN2 BCNG-2, BCNG2, HAC-1 hyperpolarization activated cyclic nucleotide gated potassium and sodium channel 2 potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2|brain cyclic nucleotide-gated channel 2|hyperpolarization activated cyclic nucleotide gated potassium channel 2

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on HCN2, check out the HCN2 Infographic

HCN2 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for HCN2: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A02804

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-HCN2 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-HCN2 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

6 Customer Q&As for Anti-HCN2 Antibody Picoband™


We are currently using anti-HCN2 antibody A02804 for rat tissue, and we are happy with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on pig tissues as well?

Verified Customer

Verified customer

Asked: 2020-01-27


The anti-HCN2 antibody (A02804) has not been tested for cross reactivity specifically with pig tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-01-27


Does A02804 anti-HCN2 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2019-09-25


As indicated on the product datasheet, A02804 anti-HCN2 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-09-25


See attached the WB image, lot number and protocol we used for heart using anti-HCN2 antibody A02804. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-07-10


Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-07-10


Can you help my question with product A02804, anti-HCN2 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

B. Dhar

Verified customer

Asked: 2019-05-22


We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A02804 anti-HCN2 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-05-22


Is there a BSA free version of anti-HCN2 antibody A02804 available?

D. Li

Verified customer

Asked: 2013-05-20


Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-HCN2 antibody A02804 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2013-05-20


Would anti-HCN2 antibody A02804 work on primate WB with c1 segment of cervical spinal cord?

T. Dhar

Verified customer

Asked: 2013-01-03


Our lab technicians have not tested anti-HCN2 antibody A02804 on primate. You can run a BLAST between primate and the immunogen sequence of anti-HCN2 antibody A02804 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated primate samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in primate c1 segment of cervical spinal cord in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2013-01-03



Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.