Anti-IBSP Antibody Picoband™

Boster Bio Anti-IBSP Antibody Picoband™ catalog # A03183. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. Cited in 3 publication(s).

Product Info Summary

SKU: A03183
Size: 100ug/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Product Name

Anti-IBSP Antibody Picoband™

See all IBSP/Sialoprotein II products

SKU/Catalog Number







Boster Bio Anti-IBSP Antibody Picoband™ catalog # A03183. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-IBSP Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A03183)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence of human IBSP (FSMKNLHRRVKIEDSEENGVFKYRPRYYLYKHAYFYPHLKRFPVQ).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A03183 is reactive to IBSP in Human, Mouse, Rat


A03183 is guaranteed for WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml

Validation Images & Assay Conditions

Gene/Protein Information For IBSP (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Bone sialoprotein 2



Alternative Names

BNSP; Bone sialoprotein 2; Bone sialoprotein; BSP 2; BSP II; BSP; BSP2; BSPII; BSP-II; Cell binding sialoprotein; IBSP; Integrin binding sialoprotein; SP II; SPII; SP-II IBSP BNSP, BSP, BSP-II, SP-II integrin binding sialoprotein bone sialoprotein 2|BSP II|bone sialoprotein II|cell-binding sialoprotein

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on IBSP, check out the IBSP Infographic

IBSP infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for IBSP: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

A03183 has been cited in 3 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Liu B,Xu M,Guo Z,Liu J,Chu X,Jiang H.Interleukin-8 promotes prostate cancer bone metastasis through upregulation of bone sialoprotein.Oncol Lett.2019 May;17(5):4607-4613.doi:10.3892/ol.2019.10138.Epub 2019 Mar 12.PMID:30988819;PMCID:PMC6447917.
Species: Human
A03183 usage in article: APP:WB, SAMPLE:LNCAP CELL AND DU145 CELL, DILUTION:1:500

Effect of kidney-reinforcing and marrow-beneficial Chinese medicine on bone metabolism-related factors following spinal cord injury in rats

The Osteogenic Potential of Mesoporous Bioglasses/Silk and Non-Mesoporous Bioglasses/Silk Scaffolds in Ovariectomized Rats: In vitro and In vivo Evaluation

Have you used Anti-IBSP Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-IBSP Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Anti-IBSP Antibody Picoband™


Total: $240

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.