Product Info Summary
SKU: | A00368 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-iNOS/NOS2 Antibody Picoband™
SKU/Catalog Number
A00368
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-iNOS/NOS2 Antibody Picoband™ catalog # A00368. Tested in WB applications. This antibody reacts with Human.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-iNOS/NOS2 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00368)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human iNOS, different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A00368 is reactive to NOS2 in Human
Applications
A00368 is guaranteed for WB Boster Guarantee
Observed Molecular Weight
130 kDa
Calculated molecular weight
131.117kDa
Background of NOS2
Nitric oxide synthase, inducible is an enzyme that in humans is encoded by the NOS2 gene. Nitric oxide (NO) is a messenger molecule with diverse functions throughout the body. In the brain and peripheral nervous system, NO displays many properties of a neurotransmitter; it is implicated in neurotoxicity associated with stroke and neurodegenerative diseases, neural regulation of smooth muscle, including peristalsis, and penile erection. Three different NOS isoforms have been identified which fall into two distinct types, constitutive and inducible. The inducible NOS (iNOS) isoform is expressed in a variety of cell types and tissues in response to inflammatory agents and cytokines. The human iNOS (NOS2) gene is approximately 37 kb in length and consists of 26 exons and 25 introns. NOS2-derived NO is a prerequisite for cytokine signaling and function in innate immunity.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of iNOS using anti-iNOS antibody (A00368).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: HELA whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-iNOS antigen affinity purified polyclonal antibody (Catalog # A00368) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for iNOS at approximately 130KD. The expected band size for iNOS is at 130KD.
Protein Target Info & Infographic
Gene/Protein Information For NOS2 (Source: Uniprot.org, NCBI)
Gene Name
NOS2
Full Name
Nitric oxide synthase, inducible
Weight
131.117kDa
Superfamily
NOS family
Alternative Names
EC 1.14.13.39; Hepatocyte NOS; HEP-NOSPeptidyl-cysteine S-nitrosylase NOS2; Inducible NO synthase; Inducible NOS; iNOS; nitric oxide synthase 2, inducible; nitric oxide synthase 2A (inducible, hepatocytes); nitric oxide synthase, inducible; nitric oxide synthase, macrophage; NOS; NOS, type II; NOS2; NOS2A; NOS2ANOS type II NOS2 HEP-NOS, INOS, NOSA, NOS2 nitric oxide synthase 2 nitric oxide synthase, inducible|NOS, type II|hepatocyte NOS|inducible NO synthase|inducible NOS|nitric oxide synthase 2, inducible|nitric oxide synthase 2A (inducible, hepatocytes)|nitric oxide synthase, macrophage|peptidyl-cysteine S-nitrosylase NOS2
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on NOS2, check out the NOS2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for NOS2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-iNOS/NOS2 Antibody Picoband™ (A00368)
Hello CJ!
A00368 has been cited in 10 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Prophylactic effects of triptolide on colon cancer development in azoxymethane/dextran sulfate sodiuminduced mouse model
Effect of erythropoietin on the expression of HIF-1 and iNOS in retina in chronic ocular hypertension rats
HIF‑1 signaling pathway involving iNOS, COX‑2 and caspase‑9 mediates the neuroprotection provided by erythropoietin in the retina of chronic ocular hypertension rats
Celastrol Attenuates Multiple Sclerosis and Optic Neuritis in an Experimental Autoimmune Encephalomyelitis Model
Diosgenin Attenuates Lipopolysaccharide-Induced Parkinson’s Disease by Inhibiting the TLR/NF- κB Pathway
Effect of ammonium pyrrolidine dithiocarbamate (PDTC) on NF-κB activation and CYP2E1 content of rats with immunological liver injury
The role of NF-κB in PARP-inhibitor-mediated sensitization and detoxification of arsenic trioxide in hepatocellular carcinoma cells
Sildenafil improves diabetic vascular activity through suppressing endothelin receptor A, iNOS and NADPH oxidase which is comparable with the endothelin receptor antagonist CPU0213 in STZ‐injected rats
Fucoidan from Undaria pinnatifida prevents vascular dysfunction through PI3K/Akt/eNOS-dependent mechanisms in the L-NAME-induced hypertensive rat model
Nifedipine inhibits oxidative stress and ameliorates osteoarthritis by activating the nuclear factor erythroid-2-related factor 2 pathway
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-iNOS/NOS2 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Submit A Review
Be the first to review Anti-iNOS/NOS2 Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
15 Customer Q&As for Anti-iNOS/NOS2 Antibody Picoband™
Question
We want to test anti-iNOS/NOS2 antibody A00368 on human glioblastoma for research purposes, then I may be interested in using anti-iNOS/NOS2 antibody A00368 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2020-05-01
Answer
The products we sell, including anti-iNOS/NOS2 antibody A00368, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2020-05-01
Question
We have been able to see staining in human colon adenocarcinoma. Any tips? Is anti-iNOS/NOS2 antibody supposed to stain colon adenocarcinoma positively?
M. Anderson
Verified customer
Asked: 2020-04-27
Answer
Based on literature colon adenocarcinoma does express NOS2. Based on Uniprot.org, NOS2 is expressed in cartilage tissue, colon adenocarcinoma, liver, chondrocyte, articular chondrocyte, retina, glioblastoma, airway epithelium, cardiac myocyte, kidney, among other tissues. Regarding which tissues have NOS2 expression, here are a few articles citing expression in various tissues:
Airway epithelium, Pubmed ID: 7544004
Articular chondrocyte, Pubmed ID: 7522054
Cardiac myocyte, Pubmed ID: 9160867
Chondrocyte, Pubmed ID: 7504305
Colon adenocarcinoma, Pubmed ID: 7692964
Glioblastoma, Pubmed ID: 7528267, 7531687
Kidney, Pubmed ID: 7532248
Liver, Pubmed ID: 7682706
Retina, Pubmed ID: 7528017
Boster Scientific Support
Answered: 2020-04-27
Question
I have attached the WB image, lot number and protocol we used for glioblastoma using anti-iNOS/NOS2 antibody A00368. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2020-04-06
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-04-06
Question
Will anti-iNOS/NOS2 antibody A00368 work for WB with glioblastoma?
Verified Customer
Verified customer
Asked: 2020-01-06
Answer
According to the expression profile of glioblastoma, NOS2 is highly expressed in glioblastoma. So, it is likely that anti-iNOS/NOS2 antibody A00368 will work for WB with glioblastoma.
Boster Scientific Support
Answered: 2020-01-06
Question
Can you help my question with product A00368, anti-iNOS/NOS2 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-12-16
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00368 anti-iNOS/NOS2 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-12-16
Question
Would A00368 anti-iNOS/NOS2 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2019-10-14
Answer
You can see on the product datasheet, A00368 anti-iNOS/NOS2 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-10-14
Question
Is a blocking peptide available for product anti-iNOS/NOS2 antibody (A00368)?
Verified Customer
Verified customer
Asked: 2019-10-03
Answer
We do provide the blocking peptide for product anti-iNOS/NOS2 antibody (A00368). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-10-03
Question
Is this A00368 anti-iNOS/NOS2 antibody reactive to the isotypes of NOS2?
Verified Customer
Verified customer
Asked: 2019-08-30
Answer
The immunogen of A00368 anti-iNOS/NOS2 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human iNOS (1088-1126aa ARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHED), different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-08-30
Question
I see that the anti-iNOS/NOS2 antibody A00368 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-06-03
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-06-03
Question
Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for glioblastoma using anti-iNOS/NOS2 antibody A00368. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-01-17
Answer
We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-01-17
Question
My boss were content with the WB result of your anti-iNOS/NOS2 antibody. However we have observed positive staining in cartilage tissue cytoplasm using this antibody. Is that expected? Could you tell me where is NOS2 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2018-01-31
Answer
From literature, cartilage tissue does express NOS2. Generally NOS2 expresses in cytoplasm, cytosol. Regarding which tissues have NOS2 expression, here are a few articles citing expression in various tissues:
Airway epithelium, Pubmed ID: 7544004
Articular chondrocyte, Pubmed ID: 7522054
Cardiac myocyte, Pubmed ID: 9160867
Chondrocyte, Pubmed ID: 7504305
Colon adenocarcinoma, Pubmed ID: 7692964
Glioblastoma, Pubmed ID: 7528267, 7531687
Kidney, Pubmed ID: 7532248
Liver, Pubmed ID: 7682706
Retina, Pubmed ID: 7528017
Boster Scientific Support
Answered: 2018-01-31
Question
I was wanting to use using your anti-iNOS/NOS2 antibody for nitric oxide mediated signal transduction studies. Has this antibody been tested with western blotting on hela whole cell lysates? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2017-09-25
Answer
Thanks for your inquiry. This A00368 anti-iNOS/NOS2 antibody is validated on hela whole cell lysates. It is guaranteed to work for WB in human. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2017-09-25
Question
We are currently using anti-iNOS/NOS2 antibody A00368 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on horse tissues as well?
N. Dhar
Verified customer
Asked: 2016-12-30
Answer
The anti-iNOS/NOS2 antibody (A00368) has not been validated for cross reactivity specifically with horse tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2016-12-30
Question
Is there a BSA free version of anti-iNOS/NOS2 antibody A00368 available?
J. Zhang
Verified customer
Asked: 2014-05-02
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-iNOS/NOS2 antibody A00368 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2014-05-02
Question
I was wanting to use your anti-iNOS/NOS2 antibody for WB for human glioblastoma on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human glioblastoma identification?
T. Kulkarni
Verified customer
Asked: 2013-10-25
Answer
You can see on the product datasheet, A00368 anti-iNOS/NOS2 antibody has been validated for WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human glioblastoma in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2013-10-25