Anti-iNOS/NOS2 Antibody Picoband®

NOS2 antibody

Boster Bio Anti-iNOS/NOS2 Antibody Picoband® catalog # A00368. Tested in IHC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 16 publication(s).

Product Info Summary

SKU: A00368
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: IHC, WB

Customers Who Bought This Also Bought

Product Name

Anti-iNOS/NOS2 Antibody Picoband®

View all NOS2 Antibodies

SKU/Catalog Number

A00368

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-iNOS/NOS2 Antibody Picoband® catalog # A00368. Tested in IHC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-iNOS/NOS2 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00368)

Host

Rabbit

Contents

Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human iNOS, different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A00368 is reactive to NOS2 in Human

Observed Molecular Weight

131 kDa

Calculated molecular weight

131.1 kDa

Background of NOS2

Nitric oxide synthase, inducible is an enzyme that in humans is encoded by the NOS2 gene. Nitric oxide (NO) is a messenger molecule with diverse functions throughout the body. In the brain and peripheral nervous system, NO displays many properties of a neurotransmitter; it is implicated in neurotoxicity associated with stroke and neurodegenerative diseases, neural regulation of smooth muscle, including peristalsis, and penile erection. Three different NOS isoforms have been identified which fall into two distinct types, constitutive and inducible. The inducible NOS (iNOS) isoform is expressed in a variety of cell types and tissues in response to inflammatory agents and cytokines. The human iNOS (NOS2) gene is approximately 37 kb in length and consists of 26 exons and 25 introns. NOS2-derived NO is a prerequisite for cytokine signaling and function in innate immunity.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A00368 is guaranteed for IHC, WB Boster Guarantee

Recommend Dilution

ApplicationDilutionSpecies
Western blot0.1-0.5μg/mlHuman
Immunohistochemistry(Paraffin-embedded Section)2-5 μg/mlHuman

Tested application

iNOS antibody was positively detected by WB in:
human Hela whole cell, human Caco-2 whole cell, human SH-SY5Y whole cell
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane
iNOS antibody was positively detected by IHC in:
human brain tissue
Use TE buffer pH 9.0 for antigen retrieval; (*) citrate buffer pH 6.0 is an alternative.

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-iNOS/NOS2 Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-iNOS/NOS2 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

15 Customer Q&As for Anti-iNOS/NOS2 Antibody Picoband®

Question

We want to test anti-iNOS/NOS2 antibody A00368 on human glioblastoma for research purposes, then I may be interested in using anti-iNOS/NOS2 antibody A00368 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2020-05-01

Answer

The products we sell, including anti-iNOS/NOS2 antibody A00368, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2020-05-01

Question

We have been able to see staining in human colon adenocarcinoma. Any tips? Is anti-iNOS/NOS2 antibody supposed to stain colon adenocarcinoma positively?

M. Anderson

Verified customer

Asked: 2020-04-27

Answer

Based on literature colon adenocarcinoma does express NOS2. Based on Uniprot.org, NOS2 is expressed in cartilage tissue, colon adenocarcinoma, liver, chondrocyte, articular chondrocyte, retina, glioblastoma, airway epithelium, cardiac myocyte, kidney, among other tissues. Regarding which tissues have NOS2 expression, here are a few articles citing expression in various tissues:
Airway epithelium, Pubmed ID: 7544004
Articular chondrocyte, Pubmed ID: 7522054
Cardiac myocyte, Pubmed ID: 9160867
Chondrocyte, Pubmed ID: 7504305
Colon adenocarcinoma, Pubmed ID: 7692964
Glioblastoma, Pubmed ID: 7528267, 7531687
Kidney, Pubmed ID: 7532248
Liver, Pubmed ID: 7682706
Retina, Pubmed ID: 7528017

Boster Scientific Support

Answered: 2020-04-27

Question

I have attached the WB image, lot number and protocol we used for glioblastoma using anti-iNOS/NOS2 antibody A00368. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2020-04-06

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-04-06

Question

Will anti-iNOS/NOS2 antibody A00368 work for WB with glioblastoma?

Verified Customer

Verified customer

Asked: 2020-01-06

Answer

According to the expression profile of glioblastoma, NOS2 is highly expressed in glioblastoma. So, it is likely that anti-iNOS/NOS2 antibody A00368 will work for WB with glioblastoma.

Boster Scientific Support

Answered: 2020-01-06

Question

Can you help my question with product A00368, anti-iNOS/NOS2 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-12-16

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00368 anti-iNOS/NOS2 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-12-16

Question

Would A00368 anti-iNOS/NOS2 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2019-10-14

Answer

You can see on the product datasheet, A00368 anti-iNOS/NOS2 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-10-14

Question

Is a blocking peptide available for product anti-iNOS/NOS2 antibody (A00368)?

Verified Customer

Verified customer

Asked: 2019-10-03

Answer

We do provide the blocking peptide for product anti-iNOS/NOS2 antibody (A00368). If you would like to place an order for it please contact support@bosterbio.com and make a special request.

Boster Scientific Support

Answered: 2019-10-03

Question

Is this A00368 anti-iNOS/NOS2 antibody reactive to the isotypes of NOS2?

Verified Customer

Verified customer

Asked: 2019-08-30

Answer

The immunogen of A00368 anti-iNOS/NOS2 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human iNOS (1088-1126aa ARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHED), different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-08-30

Question

I see that the anti-iNOS/NOS2 antibody A00368 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-06-03

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to support@bosterbio.com

Boster Scientific Support

Answered: 2019-06-03

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for glioblastoma using anti-iNOS/NOS2 antibody A00368. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-01-17

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-01-17

Question

My boss were content with the WB result of your anti-iNOS/NOS2 antibody. However we have observed positive staining in cartilage tissue cytoplasm using this antibody. Is that expected? Could you tell me where is NOS2 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2018-01-31

Answer

From literature, cartilage tissue does express NOS2. Generally NOS2 expresses in cytoplasm, cytosol. Regarding which tissues have NOS2 expression, here are a few articles citing expression in various tissues:
Airway epithelium, Pubmed ID: 7544004
Articular chondrocyte, Pubmed ID: 7522054
Cardiac myocyte, Pubmed ID: 9160867
Chondrocyte, Pubmed ID: 7504305
Colon adenocarcinoma, Pubmed ID: 7692964
Glioblastoma, Pubmed ID: 7528267, 7531687
Kidney, Pubmed ID: 7532248
Liver, Pubmed ID: 7682706
Retina, Pubmed ID: 7528017

Boster Scientific Support

Answered: 2018-01-31

Question

I was wanting to use using your anti-iNOS/NOS2 antibody for nitric oxide mediated signal transduction studies. Has this antibody been tested with western blotting on hela whole cell lysates? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2017-09-25

Answer

Thanks for your inquiry. This A00368 anti-iNOS/NOS2 antibody is validated on hela whole cell lysates. It is guaranteed to work for WB in human. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2017-09-25

Question

We are currently using anti-iNOS/NOS2 antibody A00368 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on horse tissues as well?

N. Dhar

Verified customer

Asked: 2016-12-30

Answer

The anti-iNOS/NOS2 antibody (A00368) has not been validated for cross reactivity specifically with horse tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2016-12-30

Question

Is there a BSA free version of anti-iNOS/NOS2 antibody A00368 available?

J. Zhang

Verified customer

Asked: 2014-05-02

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-iNOS/NOS2 antibody A00368 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2014-05-02

Question

I was wanting to use your anti-iNOS/NOS2 antibody for WB for human glioblastoma on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human glioblastoma identification?

T. Kulkarni

Verified customer

Asked: 2013-10-25

Answer

You can see on the product datasheet, A00368 anti-iNOS/NOS2 antibody has been validated for WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human glioblastoma in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2013-10-25

Order DetailsPrice
A00368

100μg

$370
A00368-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
A00368-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
A00368-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
A00368-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
A00368-APC

100 μg APC conjugated (liquid)

$820
A00368-FITC

100 μg FITC conjugated (liquid)

$570
A00368-Cy3

100 μg Cy3 conjugated (liquid)

$570
A00368-Biotin

100 μg Biotin conjugated (liquid)

$570
A00368-HRP

100 μg HRP conjugated (liquid)

$570
A00368-PE

100 μg PE conjugated (liquid)

$820
A00368-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
A00368
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: Sep 4, 2026