Product Info Summary
SKU: | M00587-2 |
---|---|
Size: | 100 μl/vial |
Reactive Species: | Human |
Host: | Rabbit |
Application: | IP, IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Integrin beta 3 / CD61 Rabbit Monoclonal Antibody
View all Integrin beta 3/CD61 Antibodies
SKU/Catalog Number
M00587-2
Size
100 μl/vial
Form
Liquid
Description
Boster Bio Anti-Integrin beta 3 / CD61 Rabbit Monoclonal Antibody catalog # M00587-2. Tested in WB, IHC, IP applications. This antibody reacts with Human.
Storage & Handling
Store at -20°C for one year. For short term storage and frequent use, store at 4°C for up to one month. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Integrin beta 3 / CD61 Rabbit Monoclonal Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # M00587-2)
Host
Rabbit
Contents
Rabbit IgG in phosphate buffered saline, pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol, 0.4-0.5mg/ml BSA.
Clonality
Monoclonal
Clone Number
29I49
Isotype
IgG
Immunogen
A synthesized peptide derived from human Integrin beta 3 / CD61. EDYPVDILSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDAFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSC
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Reactive Species
M00587-2 is reactive to ITGB3 in Human
Applications
M00587-2 is guaranteed for IP, IHC, WB Boster Guarantee
Observed Molecular Weight
100 kDa
Calculated molecular weight
87.058kDa
Background of Integrin beta 3/CD61
Dynamin-related GTPase required for mitochondrial fusion and regulation of apoptosis. May form a diffusion barrier for proteins stored in mitochondrial cristae. Proteolytic processing in response to intrinsic apoptotic signals may lead to disassembly of OPA1 oligomers and release of the caspase activator cytochrome C (CYCS) into the mitochondrial intermembrane space.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Assay dilution & Images
Reconsitution
Restore with deionized water (or equivalent) for reconstitution volume of 1.0 mL
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
WB 1:500-1:2000
IHC 1:50-1:200
IP 1:50
Validation Images & Assay Conditions
Click image to see more details
Western blot analysis of Integrin beta 3 / CD61 expression in U-87 MG cell lysate.
Protein Target Info & Infographic
Gene/Protein Information For ITGB3 (Source: Uniprot.org, NCBI)
Gene Name
ITGB3
Full Name
Integrin beta-3
Weight
87.058kDa
Superfamily
integrin beta chain family
Alternative Names
CD61 antigen; CD61; GP3A; GP3Aplatelet glycoprotein IIIa; GPIIIA; GPIIIaintegrin beta-3; INGRB3; Integrin beta 3; integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61); ITG B3; ITGB3; Platelet membrane glycoprotein IIIa ITGB3 BDPLT16, BDPLT2, CD61, GP3A, GPIIIa, GT integrin subunit beta 3 integrin beta-3|antigen CD61|integrin beta 3|integrin beta chain, beta 3|integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61)|platelet membrane glycoprotein IIIa
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on ITGB3, check out the ITGB3 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for ITGB3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Integrin beta 3 / CD61 Rabbit Monoclonal Antibody (M00587-2)
Hello CJ!
No publications found for M00587-2
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Integrin beta 3 / CD61 Rabbit Monoclonal Antibody?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Integrin beta 3 / CD61 Rabbit Monoclonal Antibody
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question