Anti-CD41/Integrin alpha 2b/ITGA2B Antibody Picoband™

Boster Bio Anti-CD41/Integrin alpha 2b/ITGA2B Antibody Picoband™ catalog # PB9647. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. Cited in 2 publication(s).

Product Info Summary

SKU: PB9647
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Product Name

Anti-CD41/Integrin alpha 2b/ITGA2B Antibody Picoband™

See all ITGA2B products

SKU/Catalog Number







Boster Bio Anti-CD41/Integrin alpha 2b/ITGA2B Antibody Picoband™ catalog # PB9647. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-CD41/Integrin alpha 2b/ITGA2B Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9647)




Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence at the C-terminus of human ITGA2B (677-711aa EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN), different from the related mouse sequence by four amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

PB9647 is reactive to ITGA2B in Human, Mouse, Rat


PB9647 is guaranteed for IHC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat

Validation Images & Assay Conditions

Gene/Protein Information For ITGA2B (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Integrin alpha-IIb




integrin alpha chain family

Alternative Names

CD41 antigen; CD41; CD41BHPA3; GP2B; GP2Bintegrin alpha-IIb; GPalpha IIb; GPIIb; GTA; HPA3; Integrin alpha 2b; integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigenCD41); integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigenCD41B); ITGA2b; ITGAB; platelet fibrinogen receptor, alpha subunit; Platelet membrane glycoprotein IIb; platelet-specific antigen BAK ITGA2B BDPLT16, BDPLT2, CD41, CD41B, GP2B, GPIIb, GT, GTA, HPA3, PPP1R93 integrin subunit alpha 2b integrin alpha-IIb|GPalpha IIb|alphaIIb protein|integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41)|platelet fibrinogen receptor, alpha subunit|platelet glycoprotein IIb of IIb/IIIa complex|platelet membrane glycoprotein IIb|platelet-specific antigen BAK|protein phosphatase 1, regulatory subunit 93

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on ITGA2B, check out the ITGA2B Infographic

ITGA2B infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for ITGA2B: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

PB9647 has been cited in 2 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Leila Revollo,Glenn Merrill-Skoloff,Karen De Ceunynck,James Dilks,Mattia Bordoli,Christian Peters,Leila Noetzli,Andreia Ionescu,Vicki Rosen,Joseph E. Italiano,Malcolm Whitman,Robert Flaumenhaft;The Secreted Tyrosine Kinase Vlk Is Essential for Normal Plat
Species: Human,Mouse
PB9647 usage in article: APP:WB, SAMPLE:293T CELL, DILUTION:NA

Thrombopoietic stimulating activity of rhTyrRS (Y341A)

Have you used Anti-CD41/Integrin alpha 2b/ITGA2B Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-CD41/Integrin alpha 2b/ITGA2B Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

2 Customer Q&As for Anti-CD41/Integrin alpha 2b/ITGA2B Antibody Picoband™


What is the antigen retrieval method for PB9647 antibody in IHC-P applications?

Verified customer

Asked: 2020-09-09


The antigen retrieval method used for the Anti-CD41/Integrin alpha 2b/ITGA2B Antibody Picoband PB9647 is Heat Induced Epitope Retrieval (HIER).

Boster Scientific Support

Answered: 2020-09-09


We are currently using anti-CD41/Integrin alpha 2b/ITGA2B antibody PB9647 for rat tissue, and we are satisfied with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on primate tissues as well?

Verified Customer

Verified customer

Asked: 2019-04-11


The anti-CD41/Integrin alpha 2b/ITGA2B antibody (PB9647) has not been validated for cross reactivity specifically with primate tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-04-11



Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.