Anti-KDM5B/PLU1/Jarid1B Antibody Picoband™

Boster Bio Anti-KDM5B/PLU1/Jarid1B Antibody Picoband™ catalog # PB10073. Tested in Flow Cytometry, IF, IHC-P, ICC, WB applications. This antibody reacts with Human, Monkey, Mouse, Rat.

Product Info Summary

SKU: PB10073
Size: 100μg/vial
Reactive Species: Human, Monkey, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IF, IHC-P, ICC, WB

Product Name

Anti-KDM5B/PLU1/Jarid1B Antibody Picoband™

See all Lysine (K)-specific Demethylase 5B/KDM5B/JARID1B products

SKU/Catalog Number

PB10073

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-KDM5B/PLU1/Jarid1B Antibody Picoband™ catalog # PB10073. Tested in Flow Cytometry, IF, IHC-P, ICC, WB applications. This antibody reacts with Human, Monkey, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-KDM5B/PLU1/Jarid1B Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10073)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human KDM5B (641-685aa DVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFE LL), identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

PB10073 is reactive to KDM5B in Human, Monkey, Mouse, Rat

Applications

PB10073 is guaranteed for Flow Cytometry, IF, IHC-P, ICC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat, Monkey
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For KDM5B (Source: Uniprot.Org, NCBI)

Uniprot ID

Q9UGL1

Gene ID

10765

Gene Name

KDM5B

Full Name

Lysine-specific demethylase 5B

Weight

175.658kDa

Superfamily

JARID1 histone demethylase family

Alternative Names

CT31; CT31FLJ10538; EC 1.14.11; EC 1.14.11.-; homolog 1A; Jarid1B; JARID1BFLJ16281; Jumonji, AT rich interactive domain 1B (RBP2-like); jumonji, AT rich interactive domain 1B; KDM5B; Lysine (K)specific Demethylase 5B; Lysine (K)-specific Demethylase 5B; PLU-1; PLU-1FLJ12459; PLU1FLJ23670; PUT1; RBBP2H1; RBBP2H1AFLJ12491; RBP2-H1; Retinoblastoma-binding protein 2 homolog 1 KDM5B CT31, JARID1B, MRT65, PLU-1, PLU1, PPP1R98, PUT1, RBBP2H1A, RBP2-H1 lysine demethylase 5B lysine-specific demethylase 5B|[histone H3]-trimethyl-L-lysine(4) demethylase 5B|cancer/testis antigen 31|histone demethylase JARID1B|jumonji, AT rich interactive domain 1B|jumonji/ARID domain-containing protein 1B|lysine (K)-specific demethylase 5B|protein phosphatase 1, regulatory subunit 98|putative DNA/chromatin binding motif|retinoblastoma-binding protein 2 homolog 1|retinoblastoma-binding protein 2, homolog 1A

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on KDM5B, check out the KDM5B Infographic

KDM5B infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for KDM5B: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for PB10073

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-KDM5B/PLU1/Jarid1B Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-KDM5B/PLU1/Jarid1B Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

3 Customer Q&As for Anti-KDM5B/PLU1/Jarid1B Antibody Picoband™

Question

Will anti-KDM5B/PLU1/Jarid1B antibody PB10073 work on dog WB with erythroleukemia?

Verified Customer

Verified customer

Asked: 2020-04-10

Answer

Our lab technicians have not tested anti-KDM5B/PLU1/Jarid1B antibody PB10073 on dog. You can run a BLAST between dog and the immunogen sequence of anti-KDM5B/PLU1/Jarid1B antibody PB10073 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated dog samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in dog erythroleukemia in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-04-10

Question

Is there a BSA free version of anti-KDM5B/PLU1/Jarid1B antibody PB10073 available?

Verified Customer

Verified customer

Asked: 2019-08-19

Answer

Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-KDM5B/PLU1/Jarid1B antibody PB10073 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-08-19

Question

We are currently using anti-KDM5B/PLU1/Jarid1B antibody PB10073 for rat tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on zebrafish tissues as well?

Verified Customer

Verified customer

Asked: 2017-12-28

Answer

The anti-KDM5B/PLU1/Jarid1B antibody (PB10073) has not been tested for cross reactivity specifically with zebrafish tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2017-12-28

Size

Total: $315

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
PB10073
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$315.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.