Anti-MDMX/MDM4 Antibody Picoband™

Boster Bio Anti-MDMX/MDM4 Antibody Picoband™ catalog # PB9872. Tested in IHC, WB applications. This antibody reacts with Human, Mouse.

Product Info Summary

SKU: PB9872
Size: 100μg/vial
Reactive Species: Human, Mouse
Host: Rabbit
Application: IHC, WB

Product Name

Anti-MDMX/MDM4 Antibody Picoband™

See all MDMX products

SKU/Catalog Number

PB9872

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-MDMX/MDM4 Antibody Picoband™ catalog # PB9872. Tested in IHC, WB applications. This antibody reacts with Human, Mouse.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-MDMX/MDM4 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9872)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human MDMX (35-72aa KILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQH), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

PB9872 is reactive to MDM4 in Human, Mouse

Applications

PB9872 is guaranteed for IHC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Western blot, 0.1-0.5μg/ml, Human, Mouse

Validation Images & Assay Conditions

Gene/Protein Information For MDM4 (Source: Uniprot.Org, NCBI)

Uniprot ID

O15151

Gene ID

4194

Gene Name

MDM4

Full Name

Protein Mdm4

Weight

54.864kDa

Superfamily

MDM2/MDM4 family

Alternative Names

DKFZp781B1423; double minute 4 homolog; Double minute 4 protein; double minute 4, human homolog of; p53-binding protein; HDMX; Mdm2-like p53-binding protein; Mdm4 p53 binding protein homolog (mouse); MDM4 Regulator of P53; MDM4; Mdm4, transformed 3T3 cell double minute 4, p53 binding protein (mouse); Mdm4, transformed 3T3 cell double minute 4, p53 binding protein; MDM4-related protein 1; MDMX; MDMXMGC132766; mouse double minute 4, human homolog of; p53-binding protein; MRP1; p53-binding protein Mdm4; protein Mdm4; Protein Mdmx MDM4 BMFS6, HDMX, MDMX, MRP1 MDM4 regulator of p53 protein Mdm4|MDM4 protein variant G|MDM4 protein variant Y|MDM4, p53 regulator|MDM4-related protein 1|Mdm4 p53 binding protein homolog|double minute 4, human homolog of; p53-binding protein|mdm2-like p53-binding protein|protein Mdmx

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on MDM4, check out the MDM4 Infographic

MDM4 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for MDM4: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for PB9872

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-MDMX/MDM4 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-MDMX/MDM4 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

6 Customer Q&As for Anti-MDMX/MDM4 Antibody Picoband™

Question

I was wanting to use your anti-MDMX/MDM4 antibody for IHC for human colon tumor on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human colon tumor identification?

Verified Customer

Verified customer

Asked: 2020-03-19

Answer

You can see on the product datasheet, PB9872 anti-MDMX/MDM4 antibody has been validated for IHC, WB on human, mouse tissues. We have an innovator award program that if you test this antibody and show it works in human colon tumor in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-03-19

Question

you antibody to test anti-MDMX/MDM4 antibody PB9872 on human colon tumor for research purposes, then I may be interested in using anti-MDMX/MDM4 antibody PB9872 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-09-23

Answer

The products we sell, including anti-MDMX/MDM4 antibody PB9872, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-09-23

Question

We are currently using anti-MDMX/MDM4 antibody PB9872 for human tissue, and we are content with the IHC results. The species of reactivity given in the datasheet says human, mouse. Is it true that the antibody can work on canine tissues as well?

S. Anderson

Verified customer

Asked: 2019-09-05

Answer

The anti-MDMX/MDM4 antibody (PB9872) has not been tested for cross reactivity specifically with canine tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in canine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-09-05

Question

Would anti-MDMX/MDM4 antibody PB9872 work on primate WB with gastric mucosa?

Verified Customer

Verified customer

Asked: 2019-08-07

Answer

Our lab technicians have not validated anti-MDMX/MDM4 antibody PB9872 on primate. You can run a BLAST between primate and the immunogen sequence of anti-MDMX/MDM4 antibody PB9872 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated primate samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in primate gastric mucosa in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-08-07

Question

Is a blocking peptide available for product anti-MDMX/MDM4 antibody (PB9872)?

Verified Customer

Verified customer

Asked: 2018-12-24

Answer

We do provide the blocking peptide for product anti-MDMX/MDM4 antibody (PB9872). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2018-12-24

Question

See below the WB image, lot number and protocol we used for colon tumor using anti-MDMX/MDM4 antibody PB9872. Please let me know if you require anything else.

S. Johnson

Verified customer

Asked: 2013-07-29

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2013-07-29

Conjugation

how to order through PO

Size

Total: $280

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
PB9872
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$280.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.