Anti-NM23A/NME1 Antibody

Boster Bio Anti-NM23A/NME1 Antibody catalog # RP1090. Tested in Flow Cytometry, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. Cited in 1 publication(s).

Product Info Summary

SKU: RP1090
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IHC, ICC, WB

Product Name

Anti-NM23A/NME1 Antibody

See all NME1 products

SKU/Catalog Number

RP1090

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-NM23A/NME1 Antibody catalog # RP1090. Tested in Flow Cytometry, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-NM23A/NME1 Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # RP1090)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human NM23A (26-58aa KRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDR), different from the related mouse and rat sequences by two amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

RP1090 is reactive to NME1 in Human, Mouse, Rat

Applications

RP1090 is guaranteed for Flow Cytometry, IHC, ICC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Frozen Section), 0.5-1μg/ml, Human
Immunocytochemistry, 0.5-1μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For NME1 (Source: Uniprot.Org, NCBI)

Uniprot ID

P15531

Gene ID

4830

Gene Name

NME1

Full Name

Nucleoside diphosphate kinase A

Weight

17.149kDa

Superfamily

NDK family

Alternative Names

EC 2.7.4.6; GAAD; Granzyme A-activated DNase; Metastasis inhibition factor nm23; NB; NBS; NDK A; NDKA; NDP kinase A; NDPKA; NDPK-A; NM23A; NM23AWD; NM23H1; NM23-H1; NME1; non-metastatic cells 1, protein (NM23A) expressed in; nucleoside diphosphate kinase A; Tumor metastatic process-associated protein NME1 AWD, GAAD, NB, NBS, NDKA, NDPK-A, NDPKA, NM23, NM23-H1 NME/NM23 nucleoside diphosphate kinase 1 nucleoside diphosphate kinase A|NDP kinase A|epididymis secretory sperm binding protein|granzyme A-activated DNase|metastasis inhibition factor nm23|non-metastatic cells 1, protein (NM23A) expressed in|tumor metastatic process-associated protein

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on NME1, check out the NME1 Infographic

NME1 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for NME1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

RP1090 has been cited in 1 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Mutation of the nm23-H1 gene has a non-dominant role in colorectal adenocarcinoma

Have you used Anti-NM23A/NME1 Antibody?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-NM23A/NME1 Antibody

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

1 Customer Q&As for Anti-NM23A/NME1 Antibody

Question

We are currently using anti-NM23A/NME1 antibody RP1090 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on primate tissues as well?

S. Taylor

Verified customer

Asked: 2018-11-21

Answer

The anti-NM23A/NME1 antibody (RP1090) has not been tested for cross reactivity specifically with primate tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2018-11-21

Conjugation

how to order through PO

Size

Total: $280

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
RP1090
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$280.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.