Anti-PP2A-A beta PPP2R1B Antibody

PPP2R1B antibody

Boster Bio Anti-PP2A-A beta PPP2R1B Antibody catalog # A05756-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A05756-1
Size: 100μl
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Product Name

Anti-PP2A-A beta PPP2R1B Antibody

View all PPP2R1B Antibodies

SKU/Catalog Number

A05756-1

Size

100μl

Form

Liquid

Description

Boster Bio Anti-PP2A-A beta PPP2R1B Antibody catalog # A05756-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20°C for one year. For short term storage and frequent use, store at 4°C for up to one month. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-PP2A-A beta PPP2R1B Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A05756-1)

Host

Rabbit

Contents

Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide.

Clonality

Polyclonal

Isotype

IgG

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KCNIP1 Synthetic peptide FSSLQTKQRRPSKDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLY

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Reactive Species

A05756-1 is reactive to PPP2R1B in Human, Mouse, Rat

Reconstitution

Observed Molecular Weight

39 kDa

Calculated molecular weight

66214 MW

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A05756-1 is guaranteed for WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

WB, 1:500-1:2000

Positive Control

Validation Images & Assay Conditions

Gene/Protein Information For PPP2R1B (Source: Uniprot.org, NCBI)

Gene Name

PPP2R1B

Full Name

Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform

Weight

66214 MW

Superfamily

phosphatase 2A regulatory subunit A family

Alternative Names

MGC26454; PP2A subunit A isoform PR65-beta; PP2A subunit A isoform R1-beta; PP2A, subunit A, PR65-beta isoform; PP2A, subunit A, R1-beta isoform; PP2A-Abeta; PR65B; protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), beta isoform; protein phosphatase 2 (formerly 2A), regulatory subunit A, beta isoform; protein phosphatase 2, regulatory subunit A, beta; protein phosphatase 2, structural/regulatory subunit A, beta; serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A betaisoform PPP2R1B PP2A-Abeta, PR65B protein phosphatase 2 scaffold subunit Abeta serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform|protein phosphatase 2, regulatory subunit A, beta|protein phosphatase 2, structural/regulatory subunit A, beta

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on PPP2R1B, check out the PPP2R1B Infographic

PPP2R1B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PPP2R1B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A05756-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-PP2A-A beta PPP2R1B Antibody?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-PP2A-A beta PPP2R1B Antibody

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

6 Customer Q&As for Anti-PP2A-A beta PPP2R1B Antibody

Question

We are currently using anti-PP2A-A beta antibody A05756-1 for rat tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on feline tissues as well?

Verified Customer

Verified customer

Asked: 2020-01-15

Answer

The anti-PP2A-A beta antibody (A05756-1) has not been validated for cross reactivity specifically with feline tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-01-15

Question

Is there a BSA free version of anti-PP2A-A beta antibody A05756-1 available?

Verified Customer

Verified customer

Asked: 2019-07-22

Answer

I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-PP2A-A beta antibody A05756-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-07-22

Question

I am interested in to test anti-PP2A-A beta antibody A05756-1 on rat testis thalamus for research purposes, then I may be interested in using anti-PP2A-A beta antibody A05756-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-05-22

Answer

The products we sell, including anti-PP2A-A beta antibody A05756-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-05-22

Question

My question regarding product A05756-1, anti-PP2A-A beta antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-02-20

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A05756-1 anti-PP2A-A beta antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-02-20

Question

Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for testis thalamus using anti-PP2A-A beta antibody A05756-1. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-02-07

Answer

Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-02-07

Question

Will anti-PP2A-A beta antibody A05756-1 work for WB with testis thalamus?

Verified Customer

Verified customer

Asked: 2017-12-28

Answer

According to the expression profile of testis thalamus, PPP2R1B is highly expressed in testis thalamus. So, it is likely that anti-PP2A-A beta antibody A05756-1 will work for WB with testis thalamus.

Boster Scientific Support

Answered: 2017-12-28

Order DetailsPrice
A05756-1

100uL

$399

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A05756-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$399.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.