Product Info Summary
SKU: | A00449-2 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-PPAR gamma/PPARG Antibody Picoband™
View all PPAR gamma/NR1C3 Antibodies
SKU/Catalog Number
A00449-2
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-PPAR gamma/PPARG Antibody Picoband™ catalog # A00449-2. Tested in WB applications. This antibody reacts with Human.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-PPAR gamma/PPARG Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00449-2)
Host
Rabbit
Contents
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human PPAR gamma, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A00449-2 is reactive to PPARG in Human
Applications
A00449-2 is guaranteed for WB Boster Guarantee
Observed Molecular Weight
58 kDa
Calculated molecular weight
57.62kDa
Background of PPAR gamma/NR1C3
The peroxisome proliferator-activated receptors (PPARs) are a group of three nuclear receptor isoforms, PPAR gamma, PPAR alpha, and PPAR delta, encoded by different genes. PPARs are ligand-regulated transcription factors that control gene expression by binding to specific response elements (PPREs) within promoters. PPAR gamma is a transcription factor that has a pivotal role in adipocyte differentiation and expression of adipocyte-specific genes. The PPAR gamma1 and gamma2 isoforms result from alternative splicing and have ligand-dependent and -independent activation domains. PPAR gamma is a member of a family of nuclear receptors/ligand-dependent transcription factors, which bind to hormone response elements on target gene promoters. PPAR gamma is abundantly expressed in normal lung tissues, especially in endothelial cells, but that its expression is reduced or absent in the angiogenic plexiform lesions of pulmonary hypertensive lungs and in the vascular lesions of a rat model of severe pulmonary hypertension. And it is concluded that fluid shear stress decreases the expression of PPARgamma in endothelial cells and that loss of PPARgamma expression characterizes an abnormal, proliferating, apoptosis-resistant endothelial cell phenotype.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of PPAR gamma using anti-PPAR gamma antibody (A00449-2).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human K562 whole cell lysates,
Lane 2: human MCF-7 whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-PPAR gamma antigen affinity purified polyclonal antibody (Catalog # A00449-2) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for PPAR gamma at approximately 58 kDa. The expected band size for PPAR gamma is at 58 kDa.
Protein Target Info & Infographic
Gene/Protein Information For PPARG (Source: Uniprot.org, NCBI)
Gene Name
PPARG
Full Name
Peroxisome proliferator-activated receptor gamma
Weight
57.62kDa
Superfamily
nuclear hormone receptor family
Alternative Names
CIMT1; NR1C3; NR1C3GLM1; Nuclear receptor subfamily 1 group C member 3; peroxisome proliferator-activated receptor gamma 1; peroxisome proliferator-activated receptor gamma; PPAR gamma; PPARG; PPARG1peroxisome proliferative activated receptor, gamma; PPARG2PPARgamma; PPAR-gamma PPARG CIMT1, GLM1, NR1C31, PPARG2, PPARG5, PPARgamma, PPARG peroxisome proliferator activated receptor gamma peroxisome proliferator-activated receptor gamma|PPAR-gamma|nuclear receptor subfamily 1 group C member 3|peroxisome proliferator-activated nuclear receptor gamma variant 1|peroxisome proliferator-activated receptor-gamma 5|peroxisome proliferator-activated receptor-gamma splicing
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on PPARG, check out the PPARG Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for PPARG: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-PPAR gamma/PPARG Antibody Picoband™ (A00449-2)
Hello CJ!
A00449-2 has been cited in 20 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Enhanced peroxisomal β-oxidation metabolism in visceral adipose tissues of high-fat diet-fed obesity-resistant C57BL/6 mice
Effect of Actin Alpha Cardiac Muscle 1 on the Proliferation and Differentiation of Bovine Myoblasts and Preadipocytes
Pioglitazone Ameliorates Renal Ischemia-Reperfusion Injury via Inhibition of NF-κB Activation and Inflammation in Rats
Rosiglitazone infusion therapy following minimally invasive surgery for intracerebral hemorrhage evacuation decreases matrix metalloproteinase-9 and blood–brain barrier disruption in rabbits
Scorpion in Combination with Gypsum: Novel Antidiabetic Activities in Streptozotocin-Induced Diabetic Mice by Up-Regulating Pancreatic PPARγ and PDX-1 Expressions
Bovine Stearoyl-CoA Desaturase 1 Promotes Adipogenesis by Activating the PPARγ Receptor
The effect of pleiotrophin signaling on adipogenesis
Dietary restriction reduces blood lipids and ameliorates liver function of mice with hyperlipidemia
The effect of electromagnetic fields on the proliferation and the osteogenic or adipogenic differentiation of mesenchymal stem cells modulated by dexamethasone
The effect of electromagnetic fields on the proliferation and the osteogenic or adipogenic differentiation of mesenchymal stem cells modulated by dexamethasone
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-PPAR gamma/PPARG Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-PPAR gamma/PPARG Antibody Picoband™
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
16 Customer Q&As for Anti-PPAR gamma/PPARG Antibody Picoband™
Question
See below the WB image, lot number and protocol we used for placenta using anti-PPAR gamma/PPARG antibody A00449-2. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2020-05-06
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-05-06
Question
I have a question about product A00449-2, anti-PPAR gamma/PPARG antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2020-04-16
Answer
We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00449-2 anti-PPAR gamma/PPARG antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2020-04-16
Question
Will anti-PPAR gamma/PPARG antibody A00449-2 work for Flow Cytometry with placenta?
Verified Customer
Verified customer
Asked: 2020-02-25
Answer
According to the expression profile of placenta, PPARG is highly expressed in placenta. So, it is likely that anti-PPAR gamma/PPARG antibody A00449-2 will work for Flow Cytometry with placenta.
Boster Scientific Support
Answered: 2020-02-25
Question
We were content with the WB result of your anti-PPAR gamma/PPARG antibody. However we have been able to see positive staining in adipose tissue nucleus. cytoplasm. note=redistributed from using this antibody. Is that expected? Could you tell me where is PPARG supposed to be expressed?
Verified Customer
Verified customer
Asked: 2019-10-02
Answer
Based on literature, adipose tissue does express PPARG. Generally PPARG expresses in nucleus. cytoplasm. note=redistributed from. Regarding which tissues have PPARG expression, here are a few articles citing expression in various tissues:
Adipose tissue, Pubmed ID: 8702406, 9144532
Bone marrow, Pubmed ID: 7787419
Cervix carcinoma, Pubmed ID: 23186163
Heart, Pubmed ID: 9065481
Macrophage, Pubmed ID: 25504154
Placenta, Pubmed ID: 8706692, 9356045, 15489334
Boster Scientific Support
Answered: 2019-10-02
Question
I see that the anti-PPAR gamma/PPARG antibody A00449-2 works with Flow Cytometry, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-08-21
Answer
You can find protocols for Flow Cytometry on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-08-21
Question
I was wanting to use your anti-PPAR gamma/PPARG antibody for Flow Cytometry for human placenta on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human placenta identification?
Verified Customer
Verified customer
Asked: 2019-07-03
Answer
You can see on the product datasheet, A00449-2 anti-PPAR gamma/PPARG antibody has been tested for Flow Cytometry, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human placenta in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-07-03
Question
Our lab used your anti-PPAR gamma/PPARG antibody for WB on bone marrow last year. I am using rat, and We are going to use the antibody for Flow Cytometry next. you antibody examining bone marrow as well as placenta in our next experiment. Could you please give me some suggestion on which antibody would work the best for Flow Cytometry?
Verified Customer
Verified customer
Asked: 2019-05-24
Answer
I viewed the website and datasheets of our anti-PPAR gamma/PPARG antibody and it seems that A00449-2 has been validated on rat in both WB and Flow Cytometry. Thus A00449-2 should work for your application. Our Boster satisfaction guarantee will cover this product for Flow Cytometry in rat even if the specific tissue type has not been validated. We do have a comprehensive range of products for Flow Cytometry detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2019-05-24
Question
We are currently using anti-PPAR gamma/PPARG antibody A00449-2 for human tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on dog tissues as well?
Verified Customer
Verified customer
Asked: 2019-05-13
Answer
The anti-PPAR gamma/PPARG antibody (A00449-2) has not been tested for cross reactivity specifically with dog tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-05-13
Question
Our lab want to know about to test anti-PPAR gamma/PPARG antibody A00449-2 on human placenta for research purposes, then I may be interested in using anti-PPAR gamma/PPARG antibody A00449-2 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
M. Carter
Verified customer
Asked: 2019-03-22
Answer
The products we sell, including anti-PPAR gamma/PPARG antibody A00449-2, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-03-22
Question
We have been able to see staining in human subcutaneous adipose tissue. Do you have any suggestions? Is anti-PPAR gamma/PPARG antibody supposed to stain subcutaneous adipose tissue positively?
Verified Customer
Verified customer
Asked: 2018-12-18
Answer
From what I have seen in literature subcutaneous adipose tissue does express PPARG. From what I have seen in Uniprot.org, PPARG is expressed in subcutaneous adipose tissue, heart, adipose tissue, bone marrow, placenta, cervix carcinoma, macrophage, among other tissues. Regarding which tissues have PPARG expression, here are a few articles citing expression in various tissues:
Adipose tissue, Pubmed ID: 8702406, 9144532
Bone marrow, Pubmed ID: 7787419
Cervix carcinoma, Pubmed ID: 23186163
Heart, Pubmed ID: 9065481
Macrophage, Pubmed ID: 25504154
Placenta, Pubmed ID: 8706692, 9356045, 15489334
Boster Scientific Support
Answered: 2018-12-18
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for placenta using anti-PPAR gamma/PPARG antibody A00449-2. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2018-08-14
Answer
We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-08-14
Question
Is this A00449-2 anti-PPAR gamma/PPARG antibody reactive to the isotypes of PPARG?
Verified Customer
Verified customer
Asked: 2018-04-09
Answer
The immunogen of A00449-2 anti-PPAR gamma/PPARG antibody is A synthetic peptide corresponding to a sequence in the middle region of human PPAR gamma (207-248aa AIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYD), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2018-04-09
Question
Is a blocking peptide available for product anti-PPAR gamma/PPARG antibody (A00449-2)?
G. Moore
Verified customer
Asked: 2018-02-06
Answer
We do provide the blocking peptide for product anti-PPAR gamma/PPARG antibody (A00449-2). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2018-02-06
Question
Do you have a BSA free version of anti-PPAR gamma/PPARG antibody A00449-2 available?
Verified Customer
Verified customer
Asked: 2018-01-26
Answer
Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-PPAR gamma/PPARG antibody A00449-2 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2018-01-26
Question
My question regards using your anti-PPAR gamma/PPARG antibody for regulation of pten gene transcription studies. Has this antibody been tested with western blotting on tissue lysate? We would like to see some validation images before ordering.
K. Li
Verified customer
Asked: 2016-03-01
Answer
I appreciate your inquiry. This A00449-2 anti-PPAR gamma/PPARG antibody is validated on rat lung tissue, tissue lysate, mouse lung tissue, human hela, a549 whole cell lysate, hela whole cell lysate. It is guaranteed to work for Flow Cytometry, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2016-03-01
Question
Does A00449-2 anti-PPAR gamma/PPARG antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
B. Evans
Verified customer
Asked: 2015-02-06
Answer
It shows on the product datasheet, A00449-2 anti-PPAR gamma/PPARG antibody as been validated on Flow Cytometry. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2015-02-06