Anti-PPAR gamma/PPARG Antibody Picoband®

PPARG antibody

Boster Bio Anti-PPAR gamma/PPARG Antibody Picoband® catalog # A00449-2. Tested in WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 30 publication(s).

Product Info Summary

SKU: A00449-2
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: WB

Customers Who Bought This Also Bought

Product Name

Anti-PPAR gamma/PPARG Antibody Picoband®

View all PPARG Antibodies

SKU/Catalog Number

A00449-2

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-PPAR gamma/PPARG Antibody Picoband® catalog # A00449-2. Tested in WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-PPAR gamma/PPARG Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00449-2)

Host

Rabbit

Contents

Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human PPAR gamma, identical to the related mouse and rat sequences.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A00449-2 is reactive to PPARG in Human

Observed Molecular Weight

58 kDa

Calculated molecular weight

57.6 kDa

Background of PPARG

The peroxisome proliferator-activated receptors (PPARs) are a group of three nuclear receptor isoforms, PPAR gamma, PPAR alpha, and PPAR delta, encoded by different genes. PPARs are ligand-regulated transcription factors that control gene expression by binding to specific response elements (PPREs) within promoters. PPAR gamma is a transcription factor that has a pivotal role in adipocyte differentiation and expression of adipocyte-specific genes. The PPAR gamma1 and gamma2 isoforms result from alternative splicing and have ligand-dependent and -independent activation domains. PPAR gamma is a member of a family of nuclear receptors/ligand-dependent transcription factors, which bind to hormone response elements on target gene promoters. PPAR gamma is abundantly expressed in normal lung tissues, especially in endothelial cells, but that its expression is reduced or absent in the angiogenic plexiform lesions of pulmonary hypertensive lungs and in the vascular lesions of a rat model of severe pulmonary hypertension. And it is concluded that fluid shear stress decreases the expression of PPARgamma in endothelial cells and that loss of PPARgamma expression characterizes an abnormal, proliferating, apoptosis-resistant endothelial cell phenotype.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A00449-2 is guaranteed for WB Boster Guarantee

Recommend Dilution

ApplicationDilutionSpecies
Western blot0.1-0.5μg/mlHuman

Tested application

PPAR antibody was positively detected by WB in:
human K562 whole cell, human MCF-7 whole cell
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-PPAR gamma/PPARG Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-PPAR gamma/PPARG Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

16 Customer Q&As for Anti-PPAR gamma/PPARG Antibody Picoband®

Question

See below the WB image, lot number and protocol we used for placenta using anti-PPAR gamma/PPARG antibody A00449-2. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2020-05-06

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-05-06

Question

I have a question about product A00449-2, anti-PPAR gamma/PPARG antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2020-04-16

Answer

We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00449-2 anti-PPAR gamma/PPARG antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2020-04-16

Question

Will anti-PPAR gamma/PPARG antibody A00449-2 work for Flow Cytometry with placenta?

Verified Customer

Verified customer

Asked: 2020-02-25

Answer

According to the expression profile of placenta, PPARG is highly expressed in placenta. So, it is likely that anti-PPAR gamma/PPARG antibody A00449-2 will work for Flow Cytometry with placenta.

Boster Scientific Support

Answered: 2020-02-25

Question

We were content with the WB result of your anti-PPAR gamma/PPARG antibody. However we have been able to see positive staining in adipose tissue nucleus. cytoplasm. note=redistributed from using this antibody. Is that expected? Could you tell me where is PPARG supposed to be expressed?

Verified Customer

Verified customer

Asked: 2019-10-02

Answer

Based on literature, adipose tissue does express PPARG. Generally PPARG expresses in nucleus. cytoplasm. note=redistributed from. Regarding which tissues have PPARG expression, here are a few articles citing expression in various tissues:
Adipose tissue, Pubmed ID: 8702406, 9144532
Bone marrow, Pubmed ID: 7787419
Cervix carcinoma, Pubmed ID: 23186163
Heart, Pubmed ID: 9065481
Macrophage, Pubmed ID: 25504154
Placenta, Pubmed ID: 8706692, 9356045, 15489334

Boster Scientific Support

Answered: 2019-10-02

Question

I see that the anti-PPAR gamma/PPARG antibody A00449-2 works with Flow Cytometry, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-08-21

Answer

You can find protocols for Flow Cytometry on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to support@bosterbio.com

Boster Scientific Support

Answered: 2019-08-21

Question

I was wanting to use your anti-PPAR gamma/PPARG antibody for Flow Cytometry for human placenta on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human placenta identification?

Verified Customer

Verified customer

Asked: 2019-07-03

Answer

You can see on the product datasheet, A00449-2 anti-PPAR gamma/PPARG antibody has been tested for Flow Cytometry, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human placenta in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-07-03

Question

Our lab used your anti-PPAR gamma/PPARG antibody for WB on bone marrow last year. I am using rat, and We are going to use the antibody for Flow Cytometry next. you antibody examining bone marrow as well as placenta in our next experiment. Could you please give me some suggestion on which antibody would work the best for Flow Cytometry?

Verified Customer

Verified customer

Asked: 2019-05-24

Answer

I viewed the website and datasheets of our anti-PPAR gamma/PPARG antibody and it seems that A00449-2 has been validated on rat in both WB and Flow Cytometry. Thus A00449-2 should work for your application. Our Boster satisfaction guarantee will cover this product for Flow Cytometry in rat even if the specific tissue type has not been validated. We do have a comprehensive range of products for Flow Cytometry detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2019-05-24

Question

We are currently using anti-PPAR gamma/PPARG antibody A00449-2 for human tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on dog tissues as well?

Verified Customer

Verified customer

Asked: 2019-05-13

Answer

The anti-PPAR gamma/PPARG antibody (A00449-2) has not been tested for cross reactivity specifically with dog tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-05-13

Question

Our lab want to know about to test anti-PPAR gamma/PPARG antibody A00449-2 on human placenta for research purposes, then I may be interested in using anti-PPAR gamma/PPARG antibody A00449-2 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

M. Carter

Verified customer

Asked: 2019-03-22

Answer

The products we sell, including anti-PPAR gamma/PPARG antibody A00449-2, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-03-22

Question

We have been able to see staining in human subcutaneous adipose tissue. Do you have any suggestions? Is anti-PPAR gamma/PPARG antibody supposed to stain subcutaneous adipose tissue positively?

Verified Customer

Verified customer

Asked: 2018-12-18

Answer

From what I have seen in literature subcutaneous adipose tissue does express PPARG. From what I have seen in Uniprot.org, PPARG is expressed in subcutaneous adipose tissue, heart, adipose tissue, bone marrow, placenta, cervix carcinoma, macrophage, among other tissues. Regarding which tissues have PPARG expression, here are a few articles citing expression in various tissues:
Adipose tissue, Pubmed ID: 8702406, 9144532
Bone marrow, Pubmed ID: 7787419
Cervix carcinoma, Pubmed ID: 23186163
Heart, Pubmed ID: 9065481
Macrophage, Pubmed ID: 25504154
Placenta, Pubmed ID: 8706692, 9356045, 15489334

Boster Scientific Support

Answered: 2018-12-18

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for placenta using anti-PPAR gamma/PPARG antibody A00449-2. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2018-08-14

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-08-14

Question

Is this A00449-2 anti-PPAR gamma/PPARG antibody reactive to the isotypes of PPARG?

Verified Customer

Verified customer

Asked: 2018-04-09

Answer

The immunogen of A00449-2 anti-PPAR gamma/PPARG antibody is A synthetic peptide corresponding to a sequence in the middle region of human PPAR gamma (207-248aa AIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYD), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2018-04-09

Question

Is a blocking peptide available for product anti-PPAR gamma/PPARG antibody (A00449-2)?

G. Moore

Verified customer

Asked: 2018-02-06

Answer

We do provide the blocking peptide for product anti-PPAR gamma/PPARG antibody (A00449-2). If you would like to place an order for it please contact support@bosterbio.com and make a special request.

Boster Scientific Support

Answered: 2018-02-06

Question

Do you have a BSA free version of anti-PPAR gamma/PPARG antibody A00449-2 available?

Verified Customer

Verified customer

Asked: 2018-01-26

Answer

Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-PPAR gamma/PPARG antibody A00449-2 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2018-01-26

Question

My question regards using your anti-PPAR gamma/PPARG antibody for regulation of pten gene transcription studies. Has this antibody been tested with western blotting on tissue lysate? We would like to see some validation images before ordering.

K. Li

Verified customer

Asked: 2016-03-01

Answer

I appreciate your inquiry. This A00449-2 anti-PPAR gamma/PPARG antibody is validated on rat lung tissue, tissue lysate, mouse lung tissue, human hela, a549 whole cell lysate, hela whole cell lysate. It is guaranteed to work for Flow Cytometry, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2016-03-01

Question

Does A00449-2 anti-PPAR gamma/PPARG antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

B. Evans

Verified customer

Asked: 2015-02-06

Answer

It shows on the product datasheet, A00449-2 anti-PPAR gamma/PPARG antibody as been validated on Flow Cytometry. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2015-02-06

Order DetailsPrice
A00449-2

100μg

$370
A00449-2-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
A00449-2-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
A00449-2-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
A00449-2-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
A00449-2-APC

100 μg APC conjugated (liquid)

$820
A00449-2-FITC

100 μg FITC conjugated (liquid)

$570
A00449-2-Cy3

100 μg Cy3 conjugated (liquid)

$570
A00449-2-Biotin

100 μg Biotin conjugated (liquid)

$570
A00449-2-HRP

100 μg HRP conjugated (liquid)

$570
A00449-2-PE

100 μg PE conjugated (liquid)

$820
A00449-2-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
A00449-2
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: Jun 6, 2026