Anti-PPT1 Antibody Picoband™

Boster Bio Anti-PPT1 Antibody Picoband™ catalog # PB9781. Tested in Flow Cytometry, IHC-P, IHC-F, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: PB9781
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IHC-P, IHC-F, ICC, WB

Product Name

Anti-PPT1 Antibody Picoband™

See all PPT1 products

SKU/Catalog Number







Boster Bio Anti-PPT1 Antibody Picoband™ catalog # PB9781. Tested in Flow Cytometry, IHC-P, IHC-F, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-PPT1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9781)




Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence at the C-terminus of human PPT1 (191-224aa KEDVYRNHSIFLADINQERGINESYKKNLMALKK), different from the related mouse and rat sequences by four amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

PB9781 is reactive to PPT1 in Human, Mouse, Rat


PB9781 is guaranteed for Flow Cytometry, IHC-P, IHC-F, ICC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Immunohistochemistry (Frozen Section), 0.5-1μg/ml, Human
Immunocytochemistry, 0.5-1μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For PPT1 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Palmitoyl-protein thioesterase 1




palmitoyl-protein thioesterase family

Alternative Names

ceroid-palmitoyl-palmitoyl-protein thioesterase 1; CLN1EC; INCL; Palmitoyl-protein hydrolase 1; palmitoyl-protein thioesterase 1; PPT; PPT-1 PPT1 CLN1, INCL, PPT palmitoyl-protein thioesterase 1 palmitoyl-protein thioesterase 1|ceroid-palmitoyl-palmitoyl-protein thioesterase 1|palmitoyl-protein hydrolase 1

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on PPT1, check out the PPT1 Infographic

PPT1 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for PPT1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for PB9781

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-PPT1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-PPT1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

5 Customer Q&As for Anti-PPT1 Antibody Picoband™


See below the WB image, lot number and protocol we used for liver using anti-PPT1 antibody PB9781. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2020-04-30


Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-04-30


Do you have a BSA free version of anti-PPT1 antibody PB9781 available?

Verified Customer

Verified customer

Asked: 2020-03-03


I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-PPT1 antibody PB9781 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2020-03-03


We are currently using anti-PPT1 antibody PB9781 for human tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on dog tissues as well?

Verified Customer

Verified customer

Asked: 2019-12-18


The anti-PPT1 antibody (PB9781) has not been tested for cross reactivity specifically with dog tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-12-18


Will anti-PPT1 antibody PB9781 work on goat ICC with blood?

M. Carter

Verified customer

Asked: 2017-04-13


Our lab technicians have not validated anti-PPT1 antibody PB9781 on goat. You can run a BLAST between goat and the immunogen sequence of anti-PPT1 antibody PB9781 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated goat samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in goat blood in ICC, you can get your next antibody for free.

Boster Scientific Support

Answered: 2017-04-13


Our lab want to know about to test anti-PPT1 antibody PB9781 on mouse liver for research purposes, then I may be interested in using anti-PPT1 antibody PB9781 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

R. Moore

Verified customer

Asked: 2015-02-23


The products we sell, including anti-PPT1 antibody PB9781, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2015-02-23



Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.