Anti-PROM1 Antibody Picoband™

CD133 antibody

Boster Bio Anti-PROM1 Antibody Picoband™ catalog # A01767. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. Cited in 6 publication(s).

Product Info Summary

SKU: A01767
Size: 100ug/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Product Name

Anti-PROM1 Antibody Picoband™

View all CD133 Antibodies

SKU/Catalog Number







Boster Bio Anti-PROM1 Antibody Picoband™ catalog # A01767. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-PROM1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01767)




Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence at the C-terminus of human PROM1 (808-841aa ALIFAVKLAKYYRRMDSEDVYDDVETIPMKNMEN), different from the related mouse sequence by six amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A01767 is reactive to PROM1 in Human, Mouse, Rat


A01767 is guaranteed for WB Boster Guarantee

Background of CD133

Prominin-1, also known as CD133, is a glycoprotein that in humans is encoded by the PROM1 gene. It is mapped to 4p15.32. Prominin-1 is a member of pentaspan transmembrane glycoproteins (5-transmembrane, 5-TM), which specifically localize to cellular protrusions. This gene encodes a pentaspan transmembrane glycoprotein. The protein localizes to membrane protrusions and is often expressed on adult stem cells, where it is thought to function in maintaining stem cell properties by suppressing differentiation. It has been proposed to act as an organizer of cell membrane topology. Prominin-1 was expressed not only on metastatic colon cancer cells, but also on differentiated colonic epithelium in both adult mice and humans.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat

Validation Images & Assay Conditions

Gene/Protein Information For PROM1 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name





prominin family

Alternative Names

AC133 Stargardt disease 4 (autosomal dominant); AC133; CD133 retinal 2; CD133; PROM1; prominin (mouse)-like 1; Prominin 1; PROML1 PROM1 AC133, CD133, CORD12, MCDR2, MSTP061, PROML1, RP41, STGD4 prominin 1 prominin-1|antigen AC133|hProminin|hematopoietic stem cell antigen|prominin-like protein 1

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on PROM1, check out the PROM1 Infographic

PROM1 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for PROM1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

A01767 has been cited in 6 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

A three-dimensional collagen scaffold cell culture system for screening anti-glioma therapeutics

Reversion of malignant phenotypes of human glioblastoma cells by ?-elemene through ?-catenin-mediated regulation of stemness-, differentiation- and epithelial-to-mesenchymal transition-related molecules

Promotion of Cancer Stem-Like Cell Properties in Hepatitis C Virus-Infected Hepatocytes

Dual Receptor Recognizing Cell Penetrating Peptide for Selective Targeting, Efficient Intratumoral Diffusion and Synthesized Anti-Glioma Therapy

Antagonism of Bradykinin B2 Receptor Prevents Inflammatory Responses in Human Endothelial Cells by Quenching the NF-kB Pathway Activation

Chen Q, Zhang Z, Liu J, He Q, Zhou Y, Shao G, Sun X, Cao X, Gong A, Jiang P. Mol Cells. 2015 Mar;38(3):221-8. Doi: 10.14348/Molcells.2015.2170. Epub 2015 Feb 4. A Fibrin Matrix Promotes The Differentiation Of Emscs Isolated From Nasal Respiratory ...

Have you used Anti-PROM1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-PROM1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Anti-PROM1 Antibody Picoband™


how to order through PO


Total: $315



Ask a question

Get A Quote

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

Product Categories

Primary Antibodies

Primary and Secondary Antibodies

Boster Bio offers over 16,000 antibodies that have been validated for IHC, WB, ELISA, and FC in human, mouse, and rat samples. Rabbit and mouse monoclonal antibodies as well as rabbit polyclonal antibodies are available. Buy a primary antibody and get a secondary antibody for free!



More than 1,000 ELISA kits, both singleplex and multiplex, that have been cited 6,000+ times are available at Boster. We offer our Boster-branded Picokine™ ELISA kits (sandwich ELISA) and EZ-Set™ ELISA kits (DIY antibody pairs) in addition to many multiplex ELISA kits.


Recombinant Proteins

Boster provides a wide range of human, mouse, and rat recombinant proteins, which include cytokines, growth factors, chemokines, and many more. Our recombinant proteins have high stability, biological activity, and purity.

Boster Kit


Boster offers all the reagents you need for your immunostaining and western blotting experiments. We've got everything from buffers to lysates to kits, including our popular and well-cited BCA, CCK-8, and MTT assay kits.

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.