Product Info Summary
SKU: | A01767 |
---|---|
Size: | 100ug/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-PROM1 Antibody Picoband™
SKU/Catalog Number
A01767
Size
100ug/vial
Form
Lyophilized
Description
Boster Bio Anti-PROM1 Antibody Picoband™ catalog # A01767. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-PROM1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01767)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human PROM1 (808-841aa ALIFAVKLAKYYRRMDSEDVYDDVETIPMKNMEN), different from the related mouse sequence by six amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross Reactivity
No cross reactivity with other proteins.
Reactive Species
A01767 is reactive to PROM1 in Human, Mouse, Rat
Applications
A01767 is guaranteed for WB Boster Guarantee
Background of CD133
Prominin-1, also known as CD133, is a glycoprotein that in humans is encoded by the PROM1 gene. It is mapped to 4p15.32. Prominin-1 is a member of pentaspan transmembrane glycoproteins (5-transmembrane, 5-TM), which specifically localize to cellular protrusions. This gene encodes a pentaspan transmembrane glycoprotein. The protein localizes to membrane protrusions and is often expressed on adult stem cells, where it is thought to function in maintaining stem cell properties by suppressing differentiation. It has been proposed to act as an organizer of cell membrane topology. Prominin-1 was expressed not only on metastatic colon cancer cells, but also on differentiated colonic epithelium in both adult mice and humans.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists world wide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Validation Images & Assay Conditions

Click image to see more details
Figure 1. Western blot analysis of PROM1 using anti-PROM1 antibody (A01767).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat liver tissue lysate,
Lane 2: mouse liver tissue lysate,
Lane 3: human MCF-7 whole cell lysate,
Lane 4: human COLO-320 whole cell lysate,
Lane 5: human Hela whole cell lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-PROM1 antigen affinity purified polyclonal antibody (Catalog # A01767) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for PROM1 at approximately 130KD. The expected band size for PROM1 is at 97KD.
Protein Target Info & Infographic
Gene/Protein Information For PROM1 (Source: Uniprot.Org, NCBI)
Uniprot ID
O43490
Gene ID
8842
Gene Name
PROM1
Full Name
Prominin-1
Weight
97.202kDa
Superfamily
prominin family
Alternative Names
AC133 Stargardt disease 4 (autosomal dominant); AC133; CD133 retinal 2; CD133; PROM1; prominin (mouse)-like 1; Prominin 1; PROML1 PROM1 AC133, CD133, CORD12, MCDR2, MSTP061, PROML1, RP41, STGD4 prominin 1 prominin-1|antigen AC133|hProminin|hematopoietic stem cell antigen|prominin-like protein 1
*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".For more info on PROM1, check out the PROM1 Infographic

We have 30,000+ of these available, one for each gene! check them out.
In this infographic you will see the following information for PROM1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]
Specific Publications For Anti-PROM1 Antibody Picoband™ (A01767)
A01767 has been cited in 6 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
A three-dimensional collagen scaffold cell culture system for screening anti-glioma therapeutics
Reversion of malignant phenotypes of human glioblastoma cells by ?-elemene through ?-catenin-mediated regulation of stemness-, differentiation- and epithelial-to-mesenchymal transition-related molecules
Promotion of Cancer Stem-Like Cell Properties in Hepatitis C Virus-Infected Hepatocytes
Dual Receptor Recognizing Cell Penetrating Peptide for Selective Targeting, Efficient Intratumoral Diffusion and Synthesized Anti-Glioma Therapy
Antagonism of Bradykinin B2 Receptor Prevents Inflammatory Responses in Human Endothelial Cells by Quenching the NF-kB Pathway Activation
Chen Q, Zhang Z, Liu J, He Q, Zhou Y, Shao G, Sun X, Cao X, Gong A, Jiang P. Mol Cells. 2015 Mar;38(3):221-8. Doi: 10.14348/Molcells.2015.2170. Epub 2015 Feb 4. A Fibrin Matrix Promotes The Differentiation Of Emscs Isolated From Nasal Respiratory ...
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-PROM1 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Submit A Review
Be the first to review Anti-PROM1 Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question