Anti-Proteasome 20S C2/PSMA1 Antibody Picoband™

Boster Bio Anti-Proteasome 20S C2/PSMA1 Antibody Picoband™ catalog # PB10087. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: PB10087
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Product Name

Anti-Proteasome 20S C2/PSMA1 Antibody Picoband™

See all PSMA1 products

SKU/Catalog Number







Boster Bio Anti-Proteasome 20S C2/PSMA1 Antibody Picoband™ catalog # PB10087. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Proteasome 20S C2/PSMA1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10087)




Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence at the C-terminus of human PSMA1 (159-204aa MSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLP AEQD), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

PB10087 is reactive to PSMA1 in Human, Mouse, Rat


PB10087 is guaranteed for IHC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat

Validation Images & Assay Conditions

Gene/Protein Information For PSMA1 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Proteasome subunit alpha type-1




peptidase T1A family

Alternative Names

Macropain Subunit C2; P30-33K; PROS30; Proteasome Component C2; Proteasome nu Chain; PSC2; PSMA1 PSMA1 HC2, HEL-S-275, NU, PROS30 proteasome 20S subunit alpha 1 proteasome subunit alpha type-1|30 kDa prosomal protein|PROS-30|epididymis secretory protein Li 275|macropain subunit C2|macropain subunit nu|multicatalytic endopeptidase complex subunit C2|proteasome (prosome, macropain) subunit, alpha type, 1|proteasome component C2|proteasome nu chain|proteasome subunit alpha 1|proteasome subunit alpha 6|proteasome subunit nu|proteasome subunit, alpha-type, 1|protein P30-33K|testicular tissue protein Li 150

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on PSMA1, check out the PSMA1 Infographic

PSMA1 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for PSMA1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for PB10087

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Proteasome 20S C2/PSMA1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Proteasome 20S C2/PSMA1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

1 Customer Q&As for Anti-Proteasome 20S C2/PSMA1 Antibody Picoband™


We are currently using anti-Proteasome 20S C2/PSMA1 antibody PB10087 for human tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on horse tissues as well?

Verified Customer

Verified customer

Asked: 2019-08-22


The anti-Proteasome 20S C2/PSMA1 antibody (PB10087) has not been tested for cross reactivity specifically with horse tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-08-22



Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.