Anti-TNF alpha Antibody

Boster Bio Anti-TNF alpha Antibody catalog # PA1079. Tested in IF, IHC-P, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. Cited in 79 publication(s).

Product Info Summary

SKU: PA1079
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IF, IHC-P, ICC, WB

Product Name

Anti-TNF alpha Antibody

See all TNF-alpha products

SKU/Catalog Number

PA1079

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-TNF alpha Antibody catalog # PA1079. Tested in IF, IHC-P, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-TNF alpha Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # PA1079)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Thimerosal, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human TNF (201-233aa QLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL), different from the related mouse sequence by five amino acids, and rat sequence by seven amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

PA1079 is reactive to TNF in Human, Mouse, Rat

Applications

PA1079 is guaranteed for IF, IHC-P, ICC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat

Validation Images & Assay Conditions

Gene/Protein Information For TNF (Source: Uniprot.Org, NCBI)

Uniprot ID

P01375

Gene ID

7124

Gene Name

TNF

Full Name

Tumor necrosis factor

Weight

25.644kDa

Superfamily

Tumor necrosis factor family

Alternative Names

APC1 protein; Cachectin; Cachetin; DIF; TNF; TNF, monocyte-derived; TNFA; TNF-A; TNFalpha; TNF-alpha; TNF-alphacachectin; TNFATNF, macrophage-derived; TNFG1F; TNFSF1A; TNFSF2; TNFSF2TNF superfamily, member 2; tumor necrosis factor (TNF superfamily, member 2); tumor necrosis factor alpha; Tumor necrosis factor ligand superfamily member 2; tumor necrosis factor; tumor necrosis factor-alpha TNF DIF-alpha, TNFA, TNFSF2, TNLG1F, TNF tumor necrosis factor tumor necrosis factor|APC1 protein|TNF, macrophage-derived|TNF, monocyte-derived|TNF-a|tumor necrosis factor ligand 1F|tumor necrosis factor ligand superfamily member 2|tumor necrosis factor-alpha

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on TNF, check out the TNF Infographic

TNF infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for TNF: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

PA1079 has been cited in 79 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Wang B,Gao C,Zhang P,Sun W,Zhang J,Gao J.The increased motion of lumbar induces ligamentum flavum hypertrophy in a rat model. BMC Musculoskelet Disord.2021 Apr 6;22(1):334.doi:10.1186/s12891-021-04203-x.PMID:33823825.
Species: Human,Rat
PA1079 usage in article: APP:IHC, SAMPLE:SPINAL CORD TISSUE, DILUTION:1: 100

Yang Ping,Yingpeng Li,Shaowa Lü,Yali Sun,Wanmeng Zhang,Jialin Wu,Ting Liu,Yongji Li,A study of nanometre aggregates formation mechanism and antipyretic effect in Bai-Hu-Tang, an ancient Chinese herbal decoction,Biomedicine & Pharmacotherapy,Volume 124,202
Species: Rat
PA1079 usage in article: APP:WB, SAMPLE:HYPOTHALMIC TISSUE, DILUTION:NA

El Naggar EE,Mohamed EA,Borg TM,El-Sheakh AR,Hamed MF.Colon Targeting of Naringin for Enhanced Cytoprotection Against Indomethacin-Induced Colitis in Rabbits.Drug Des Devel Ther.2020 Feb 19;14:677-696.doi:10.2147/DDDT.S218357.PMID:32109993;PMCID:PMC703841
Species: New Zealand Rabbit
PA1079 usage in article: APP:IHC, SAMPLE:COLON TISSUE, DILUTION:1:100

Baojian Wang,Chunyu Gao,Liguo Zhu et al.Lumbar Instability Induces Ligamentum Flavum Hypertrophy in a Rat Model, 08 January 2021, PREPRINT (Version 1) available at Research Square [https://doi.org/10.21203/rs.3.rs-140228/v1]
Species: Human,Rat
PA1079 usage in article: APP:IHC, SAMPLE:POSTERIOR LUMBAR SPINAL TISSUE, DILUTION:1:100

Dan min Wang,Yao Gong,Zhi duo Hou et al.Comparison of Sacroiliac Biopsies and Magnetic Resonance Imaging Examinations in Non-Radiographic Axial Spondyloarthritis, 05 January 2021, PREPRINT (Version 1) available at Research Square [https://doi.org/10.21203
Species: Human
PA1079 usage in article: APP:IHC, SAMPLE:SIJ TISSUE, DILUTION:NA

Yang QQ,Li HN,Zhang ST,Yu YL,Wei W,Zhang X,Wang JY,Zeng XY.Red nucleus IL-6 mediates the maintenance of neuropathic pain by inducing the productions of TNF-α and IL-1β through the JAK2/STAT3 and ERK signaling pathways.Neuropathology.2020 Aug;40(4):347-357
Species: Rat
PA1079 usage in article: APP:WB, SAMPLE:RN TISSUE, DILUTION:1:300

Lan Q,Lu R,Chen H,Pang Y, Xiong F,Shen C,Qin Z,Zheng L,Xu G,Zhao J.MMP-13 enzyme and pH responsive theranostic nanoplatform for osteoarthritis.J Nanobiotechnology.2020 Aug 27;18(1):117.doi:10.1186/s12951-020-00666-7. PMID:32854712;PMCID:PMC7450974.
Species: Mouse
PA1079 usage in article: APP:IF, SAMPLE:CHONDROCYTES, DILUTION:1:100

Sun S,Wang Y,Du Y,Sun Q,He L,Zhu E,Li J. Oxidative stress-mediated hepatotoxicity in rats induced by ethanol extracts of different parts of Chloranthus serratus.Pharm Biol.2020 Dec;58(1):1277-1289.doi:10.1080/ n13880209.2020.1859552.PMID: 33355514.
Species: Rat
PA1079 usage in article: APP:IHC, SAMPLE:LIVER TISSUE, DILUTION:NA

Guo Y,Gu R,Yu J,Lei B,Gan D,Xu G.Synthetic Glucocorticoid-Induced Leucine Zipper Peptide Inhibits Lipopolysaccharide-Induced Ocular Inflammation in Rats.Ophthalmic Res.2020;63(4):434-442.doi:10.1159/000505 003.Epub 2019 Nov 26.PMID:31770752.
Species: Rat
PA1079 usage in article: APP:WB, SAMPLE:RETINAL TISSUE, DILUTION:1:500

Qi MY,Wang XT,Xu HL,Yang ZL,Cheng Y,Zhou B.Protective effect of ferulic acid on STZ-induced diabetic nephropathy in rats.Food Funct.2020 Apr 1;11(4):3706-3718.doi:10.1039/c9fo02398d.Epub 2020 Apr 20. PMID:32307498.
Species: Rat
PA1079 usage in article: APP:WB, SAMPLE:KIDNEY TISSUE, DILUTION:1:1000

Liao H,Li Y,Zhang X,Zhao X,Zheng D,Shen D,Li R. Protective Effects of Thalidomide on High-Glucose-Induced Podocyte Injury through In Vitro Modulation of Macrophage M1/M2 Differentiation.J Immunol Res.2020 Aug 27;2020:8263598.doi:10.1155/2020/ 8263598.PMID
Species: Mouse
PA1079 usage in article: APP:WB, SAMPLE:MACROPHAGES, DILUTION:1:500

Zhao B,Li S,Guo Z,Chen Z,Zhang X,Xu C,Chen J,Wei C. Dopamine receptor D2 inhibition alleviates diabetic hepatic stellate cells fibrosis by regulating the TGF-β1/Smads and NFκB pathways. Clin Exp Pharmacol Physiol.2020 Nov 11.doi:10.1111/1440-1681.13437.Ep
Species: Rat
PA1079 usage in article: APP:WB, SAMPLE:LIVER TISSUE AND HSCS, DILUTION:NA

Huang CL,Liu F,Zhang YY,Lin J,Fu M,Li YL, Zhou C,Li CJ,Shen JF. Activation of oxytocin receptor in the trigeminal ganglion attenuates orofacial ectopic pain attributed to inferior alveolar nerve injury. J Neurophysiol.2020 Dec 16.doi:10.1152/jn.00646. 202
Species: Rat
PA1079 usage in article: APP:WB, SAMPLE:TG CELL AND SPVC CELL, DILUTION:1:1000

Dan min Wang,Yao Gong,Zhi duo Hou et al.Comparison of Sacroiliac Biopsies and Magnetic Resonance Imaging Examinations in Non-Radiographic Axial Spondyloarthritis, 05 January 2021, PREPRINT (Version 1) available at Research Square [https://doi.org/10.21203
Species: Human
PA1079 usage in article: APP:IHC, SAMPLE:SIJ TISSUE, DILUTION:NA

The effect of oral and intraurethral trimetazidine use on urethral healing

Synergistic action of inflammation and lipid dysmetabolism on kidney damage in rats

Renal ischemia-reperfusion injury attenuated by splenic ischemic preconditioning

Effects of triptolide from Radix Tripterygium wilfordii (Leigongteng) on cartilage cytokines and transcription factor NF-%u03BAB: a study on induced arthritis in rats

Resveratrol attenuates hyperoxia%u2010induced oxidative stress, inflammation and fibrosis and suppresses Wnt/%u03B2%u2010catenin signalling in lungs of neonatal rats

Efficacy of acetylshikonin in preventing obesity and hepatic steatosis in db/db mice

Protective effects of baicalin on carbon tetrachloride induced liver injury by activating PPAR%u03B3 and inhibiting TGF%u03B21

Immunomodulatory properties of quercetin-3-O-%u03B1-L-rhamnopyranoside from Rapanea melanophloeos against influenza a virus

Neuroprotective effects of %u03B1-lipoic acid on long-term experimental autoimmune encephalomyelitis.

Polymeric micelles for potentiated antiulcer and anticancer activities of naringin

Rhein inhibits lipopolysaccharide-induced intestinal injury during sepsis by blocking the toll-like receptor 4 nuclear factor-%u03BAB pathway

Pannus inflammation in sacroiliitis following immune pathological injury and radiological structural damage: a study of 193 patients with spondyloarthritis

Involvement of tumor necrosis factor-%u03B1 in the upregulation of CXCR4 expression in gastric cancer induced by Helicobacter pylori

Effects of aqueous extracts of Taraxacum Officinale on expression of tumor necrosis factor-alpha and intracellular adhesion molecule 1 in LPS-stimulated %u2026

Characterization of acetaminophen-induced cytotoxicity in target tissues

Carbon monoxide-releasing molecule-3 protects against ischemic stroke by suppressing neuroinflammation and alleviating blood-brain barrier disruption

BML-111 reduces neuroinflammation and cognitive impairment in mice with sepsis via the SIRT1/NF-%u03BAB signaling pathway.

Puerarin protects brain tissue against cerebral ischemia/reperfusion injury by inhibiting the inflammatory response

Protective effects of thalidomide on pulmonary injuries in a rat model of paraquat intoxication

Comparison of Serum Levels of Vitamin D and Inflammatory Markers Between Women With Gestational Diabetes Mellitus and Healthy Pregnant Control

Pentoxifylline inhibits pulmonary inflammation induced by infrarenal aorticcross-clamping dependent of adenosine receptor A2A

In Vivo Evaluation of the Ameliorating Effects of Small-Volume Resuscitation with Four Different Fluids on Endotoxemia-Induced Kidney Injury

Methionine Sulfoxide Reductase A Negatively Controls Microglia-Mediated Neuroinflammation via Inhibiting ROS/MAPKs/NF-?B Signaling Pathways Through a Catalytic Antioxidant Function

Neuroprotective effect of pretreatment with ganoderma lucidum in cerebral ischemia/reperfusion injury in rat hippocampus

Effect of Aspirin on the Expression of Hepatocyte NF-?B and Serum TNF-? in Streptozotocin-Induced Type 2 Diabetic Rats

Gu, R., Tang, W., Lei, B., Ding, X., Jiang, C., & Xu, G. (2017). Glucocorticoid-Induced Leucine Zipper Protects the Retina From Light-Induced Retinal Degeneration by Inducing Bcl-xL in Rats. Investigative Ophthalmology & Visual Science, 58(9), 365...

Lu Nn, Liu Q, Gu Lg, Ge Sj, Wu J, Ze-Ji Q, Qiu Zj, Zhang Hc, Chao Ex, Yu Zn. Evid Based Complement Alternat Med. 2014;2014:976364. Doi: 10.1155/2014/976364. Epub 2014 Jan 8. Gene Expression Profiles Underlying Selective T-Cell-Mediated Immunity Ac...

Wu W, Su M, Li T, Wu K, Wu X, Tang Z. Int Immunopharmacol. 2015 Sep;28(1):182-7. Doi: 10.1016/J.Intimp.2015.06.003. Epub 2015 Jun 10. Cantharidin-Induced Liver Injuries In Mice And The Protective Effect Of Vitamin C Supplementation.

Qiang G, Zhang L, Yang X, Xuan Q, Shi L, Zhang H, Chen B, Li X, Zu M, Zhou D, Guo J, Yang H, Du G. Eur J Pharmacol. 2012 Jun 15;685(1-3):156-64. Doi: 10.1016/J.Ejphar.2012.04.028. Epub 2012 Apr 21. Effect Of Valsartan On The Pathological Progressi...

Sun J, Chen Lj, Zhang Gb, Jiang Jt, Zhu M, Tan Y, Wang Ht, Lu Bf, Zhang Xg. Cancer Immunol Immunother. 2010 Aug;59(8):1163-71. Doi: 10.1007/S00262-010-0841-1. Epub 2010 Mar 24. Clinical Significance And Regulation Of The Costimulatory Molecule B7-...

Xie Jb, Zhang X, Li Qh, Xu Zj. Neural Regen Res. 2015 Feb;10(2):219-24. Doi: 10.4103/1673-5374.152374. Inhibition Of Inflammatory Cytokines After Early Decompression May Mediate Recovery Of Neurological Function In Rats With Spinal Cord Injury.

Xia W, Li Dw, Xiang L, Chang Jj, Xia Zl, Han Ej. Chin J Physiol. 2015 Apr 30;58(2):104-13. Doi: 10.4077/Cjp.2015.Bad273. Neuroprotective Effects Of An Aqueous Extract Of Futokadsura Stem In An A??-Induced Alzheimer'S Disease-Like Rat Model.

Li H, Qiu P, Wang J, Niu C, Pan S. Food Funct. 2015 Feb;6(2):470-8. Doi: 10.1039/C4Fo00739E. Effects Of Compound Ginkgo Biloba On Intestinal Permeability In Rats With Alcohol-Induced Liver Injury.

Li C, Chen X, Zhang N, Song Y, Mu Y. Neural Regen Res. 2012 Feb 15;7(5):325-31. Doi: 10.3969/J.Issn.1673-5374.2012.05.001. Gastrodin Inhibits Neuroinflammation In Rotenone-Induced Parkinson'S Disease Model Rats.

Jiang Gt, Chen X, Li D, An Hx, Jiao Jd. Mol Med Rep. 2014 Sep;10(3):1501-8. Doi: 10.3892/Mmr.2014.2323. Epub 2014 Jun 13. Ulinastatin Attenuates Renal Interstitial Inflammation And Inhibits Fibrosis Progression In Rats Under Unilateral Ureteral Ob...

Li G, Ren J, Wang G, Gu G, Hu D, Ren H, Hong Z, Wu X, Liu S, Li J. Int Immunopharmacol. 2014 Feb;18(2):244-8. Doi: 10.1016/J.Intimp.2013.12.014. Epub 2013 Dec 22. T2 Enhances In Situ Level Of Foxp3+ Regulatory Cells And Modulates Inflammatory Cyto...

Jin Hb, Yang Yb, Song Yl, Zhang Yc, Li Yr. Mol Biol Rep. 2012 Dec;39(12):11005-9. Doi: 10.1007/S11033-012-2002-4. Epub 2012 Oct 8. Protective Roles Of Quercetin In Acute Myocardial Ischemia And Reperfusion Injury In Rats.

Ye Q, Zheng Y, Fan S, Qin Z, Li N, Tang A, Ai F, Zhang X, Bian Y, Dang W, Huang J, Zhou M, Zhou Y, Xiong W, Yan Q, Ma J, Li G. Plos One. 2014 Jul 24;9(7):E103298. Doi: 10.1371/Journal.Pone.0103298. Ecollection 2014. Lactoferrin Deficiency Promotes...

Zhao H, Li X, Li N, Liu T, Liu J, Li Z, Xiao H, Li J. Br J Nutr. 2014 Mar 14;111(5):836-46. Doi: 10.1017/S0007114513003115. Epub 2013 Sep 30. Long-Term Resveratrol Treatment Prevents Ovariectomy-Induced Osteopenia In Rats Without Hyperplastic Effe...

Li J, Zhang J, Fu Y, Sun X, Gong T, Jiang J, Zhang Z. J Control Release. 2015 Aug 28;212:19-29. Doi: 10.1016/J.Jconrel.2015.06.011. Epub 2015 Jun 11. Dual Pancreas- And Lung-Targeting Therapy For Local And Systemic Complications Of Acute Pancreati...

Wang T, Zhou Yt, Chen Xn, Zhu Ax. Braz J Med Biol Res. 2014 Sep;47(9):738-45. Epub 2014 Jul 25. Putative Role Of Ischemic Postconditioning In A Rat Model Of Limb Ischemia And Reperfusion: Involvement Of Hypoxia-Inducible Factor-1?? Expression.

Huang Q, Du J, Fan J, Lv Z, Qian X, Zhang X, Han J, Chen C, Wu F, Jin Y. Med Oncol. 2014 Sep;31(9):144. Doi: 10.1007/S12032-014-0144-Z. Epub 2014 Aug 12. The Effect Of Proinflammatory Cytokines On Il-17Ra Expression In Nsclc.

Guo J, Li F, Wu Q, Gong Q, Lu Y, Shi J. Phytomedicine. 2010 Oct;17(12):950-5. Doi: 10.1016/J.Phymed.2010.03.007. Epub 2010 Apr 9. Protective Effects Of Icariin On Brain Dysfunction Induced By Lipopolysaccharide In Rats.

Cen J, Liu L, Li Ms, He L, Wang Lj, Liu Yq, Liu M, Ji Bs. J Pharm Pharmacol. 2013 May;65(5):665-72. Doi: 10.1111/Jphp.12033. Epub 2013 Feb 26. Alteration In P-Glycoprotein At The Blood-Brain Barrier In The Early Period Of Mcao In Rats.

Cui Wy, Tian Ay, Bai T. Clin Exp Pharmacol Physiol. 2011 Nov;38(11):747-54. Doi: 10.1111/J.1440-1681.2011.05584.X. Protective Effects Of Propofol On Endotoxemia-Induced Acute Kidney Injury In Rats.

Ran J, Ma J, Liu Y, Tan R, Liu H, Lao G. J Diabetes Res. 2014;2014:287536. Doi: 10.1155/2014/287536. Epub 2014 Mar 13. Low Protein Diet Inhibits Uric Acid Synthesis And Attenuates Renal Damage In Streptozotocin-Induced Diabetic Rats.

Li Q, Xia Yy, Tang Jc, Wang Ry, Bei Cy, Zeng Y. Artif Cells Blood Substit Immobil Biotechnol. 2011 Jun;39(3):137-42. Doi: 10.3109/10731199.2010.502880. Epub 2010 Jul 23. In Vitro And In Vivo Biocompatibility Investigation Of Diamond-Like Carbon Co...

Liu T, Zeng Z, Liu Y, Wang J, Maitz Mf, Wang Y, Liu S, Chen J, Huang N. Acs Appl Mater Interfaces. 2014 Jun 11;6(11):8729-43. Doi: 10.1021/Am5015309. Epub 2014 Apr 23. Surface Modification With Dopamine And Heparin/Poly-L-Lysine Nanoparticles Prov...

Jiang Zy, Guo Yy, Ren Hb, Zou Yf, Fan Ms, Lv Y, Han P, De W, Sun Lz. Placenta. 2012 Jan;33(1):1-7. Doi: 10.1016/J.Placenta.2011.09.004. Epub 2011 Nov 1. Tumor Necrosis Factor (Tnf)-?? Upregulates Progesterone Receptor-A By Activating The Nf-??b Si...

Zhang Y, Zhang Y, Xie Y, Gao Y, Ma J, Yuan J, Li J, Wang J, Li L, Zhang J, Chu L. J Ethnopharmacol. 2013 Jul 9;148(2):671-81. Doi: 10.1016/J.Jep.2013.05.028. Epub 2013 May 22. Multitargeted Inhibition Of Hepatic Fibrosis In Chronic Iron-Overloaded...

Kan S, Zhou H, Jin C, Yang H. Int J Clin Exp Med. 2015 Mar 15;8(3):3258-70. Ecollection 2015. Effects Of Pdtc On Nf-??b Expression And Apoptosis In Rats With Severe Acute Pancreatitis-Associated Lung Injury.

Qin Q, Niu J, Wang Z, Xu W, Qiao Z, Gu Y. Int J Mol Sci. 2012;13(7):8379-87. Doi: 10.3390/Ijms13078379. Epub 2012 Jul 5. Astragalus Membranaceus Inhibits Inflammation Via Phospho-P38 Mitogen-Activated Protein Kinase (Mapk) And Nuclear Factor (Nf)-...

Zhang S, Liu X, Goldstein S, Li Y, Ge J, He B, Fei X, Wang Z, Ruiz G. Mol Med Rep. 2013 Jan;7(1):93-8. Doi: 10.3892/Mmr.2012.1159. Epub 2012 Oct 29. Role Of The Jak/Stat Signaling Pathway In The Pathogenesis Of Acute Myocardial Infarction In Rats ...

Zhang Z, Wu Y, Zhao Y, Xiao X, Liu J, Zhou X. Exp Ther Med. 2013 May;5(5):1523-1527. Epub 2013 Mar 22. Dynamic Changes In Hmgb1 Levels Correlate With Inflammatory Responses During Cardiopulmonary Bypass.

Jiang Z, Han B, Li H, Yang Y, Liu W. Carbohydr Polym. 2015 Sep 20;129:1-8. Doi: 10.1016/J.Carbpol.2015.04.040. Epub 2015 Apr 27. Carboxymethyl Chitosan Represses Tumor Angiogenesis In Vitro And In Vivo.

Hou Sx, Zhu Wj, Pang Mq, Jeffry J, Zhou Ll. Food Chem Toxicol. 2014 Feb;64:57-64. Doi: 10.1016/J.Fct.2013.11.022. Epub 2013 Nov 26. Protective Effect Of Iridoid Glycosides From Paederia Scandens (Lour.) Merrill (Rubiaceae) On Uric Acid Nephropathy...

Li X, Qian D, Ju F, Wang B. Oncol Lett. 2015 Jan;9(1):365-370. Epub 2014 Oct 15. Upregulation Of Toll-Like Receptor 2 Expression In Colorectal Cancer Infected By Human Cytomegalovirus.

Zhou Ch, Wan Yy, Chu Xh, Song Z, Xing Sh, Wu Yq, Yin Xx. Oncol Lett. 2012 Dec;4(6):1259-1263. Epub 2012 Sep 21. Urotensin Ii Contributes To The Formation Of Lung Adenocarcinoma Inflammatory Microenvironment Through The Nf-??b Pathway In Tumor-Bear...

Chen Yf, Zhao Zq, Wu Zm, Zou Zy, Luo Xj, Li J, Xie C, Liang Y. Int J Clin Exp Pathol. 2014 Dec 1;7(12):8411-20. Ecollection 2014. The Role Of Rip1 And Rip3 In The Development Of Aplastic Anemia Induced By Cyclophosphamide And Busulphan In Mice.

Shi L, Song J, Zhang X, Li Y, Li H. Exp Ther Med. 2013 Aug;6(2):532-536. Epub 2013 May 28. Correlation Between The Microinflammatory State And Left Ventricular Structural And Functional Changes In Maintenance Haemodialysis Patients.

Presti I, D'Orazio G, Labra M, La Ferla B, Mezzasalma V, Bizzaro G, Giardina S, Michelotti A, Tursi F, Vassallo M, Di Gennaro P. Appl Microbiol Biotechnol. 2015 Jul;99(13):5613-26. Doi: 10.1007/S00253-015-6482-8. Epub 2015 Mar 7. Evaluation Of The...

Zhang W, Chen Dq, Qi F, Wang J, Xiao Wy, Zhu Wz. J Cardiovasc Pharmacol. 2010 Jan;55(1):96-105. Doi: 10.1097/Fjc.0B013E3181C9548B. Inhibition Of Calcium-Calmodulin-Dependent Kinase Ii Suppresses Cardiac Fibroblast Proliferation And Extracellular M...

Qin Jh, Ma Jz, Yang Xw, Hu Yj, Zhou J, Fu Lc, Tian Rh, Liu S, Xu G, Shen Xl. Nat Prod Bioprospect. 2015 Jun;5(3):159-66. Doi: 10.1007/S13659-015-0063-5. Epub 2015 Jun 16. A Triterpenoid Inhibited Hormone-Induced Adipocyte Differentiation And Allev...

Wu Yh, Hu Sq, Liu J, Cao Hc, Xu W, Li Yj, Li Lj. Int J Mol Med. 2014 Jun;33(6):1498-506. Doi: 10.3892/Ijmm.2014.1730. Epub 2014 Apr 7. Nature And Mechanisms Of Hepatocyte Apoptosis Induced By D-Galactosamine/Lipopolysaccharide Challenge In Mice.

Liu W, Shan Lp, Dong Xs, Liu Xw, Ma T, Liu Z. World J Gastroenterol. 2013 Jan 28;19(4):492-502. Doi: 10.3748/Wjg.V19.I4.492. Combined Early Fluid Resuscitation And Hydrogen Inhalation Attenuates Lung And Intestine Injury.

Have you used Anti-TNF alpha Antibody?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-TNF alpha Antibody

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

16 Customer Q&As for Anti-TNF alpha Antibody

Question

We are currently using anti-TNF alpha antibody PA1079 for rat tissue, and we are happy with the IF results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on bovine tissues as well?

Verified Customer

Verified customer

Asked: 2020-05-01

Answer

The anti-TNF alpha antibody (PA1079) has not been validated for cross reactivity specifically with bovine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-05-01

Question

I see that the anti-TNF alpha antibody PA1079 works with IF, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2020-04-17

Answer

You can find protocols for IF on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2020-04-17

Question

Do you have a BSA free version of anti-TNF alpha antibody PA1079 available?

Verified Customer

Verified customer

Asked: 2020-02-25

Answer

Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-TNF alpha antibody PA1079 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2020-02-25

Question

My lab would like using your anti-TNF alpha antibody for positive regulation of membrane protein ectodomain proteolysis studies. Has this antibody been tested with western blotting on a431 whole cell lysates? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2019-12-23

Answer

We appreciate your inquiry. This PA1079 anti-TNF alpha antibody is tested on human placenta tissue, hela whole cell lysates, a431 whole cell lysates, a549 whole cell lysates, k562 whole cell lysates. It is guaranteed to work for IF, IHC-P, ICC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2019-12-23

Question

Our lab want to know about to test anti-TNF alpha antibody PA1079 on mouse prostatic carcinoma for research purposes, then I may be interested in using anti-TNF alpha antibody PA1079 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

W. Wu

Verified customer

Asked: 2019-11-18

Answer

The products we sell, including anti-TNF alpha antibody PA1079, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-11-18

Question

Is a blocking peptide available for product anti-TNF alpha antibody (PA1079)?

Verified Customer

Verified customer

Asked: 2019-06-13

Answer

We do provide the blocking peptide for product anti-TNF alpha antibody (PA1079). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-06-13

Question

See attached the WB image, lot number and protocol we used for prostatic carcinoma using anti-TNF alpha antibody PA1079. Please let me know if you require anything else.

R. Thomas

Verified customer

Asked: 2019-06-12

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-06-12

Question

We ordered your anti-TNF alpha antibody for IHC-P on leukocyte a few years ago. I am using rat, and We are going to use the antibody for WB next. I am interested in examining leukocyte as well as prostatic carcinoma in our next experiment. Could you please give me some suggestion on which antibody would work the best for WB?

J. Krishna

Verified customer

Asked: 2019-05-31

Answer

I viewed the website and datasheets of our anti-TNF alpha antibody and it appears that PA1079 has been tested on rat in both IHC-P and WB. Thus PA1079 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in rat even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2019-05-31

Question

My question regarding product PA1079, anti-TNF alpha antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2018-08-06

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PA1079 anti-TNF alpha antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2018-08-06

Question

Our lab were well pleased with the WB result of your anti-TNF alpha antibody. However we have observed positive staining in blood cell membrane using this antibody. Is that expected? Could you tell me where is TNF supposed to be expressed?

Verified Customer

Verified customer

Asked: 2017-07-24

Answer

From literature, blood does express TNF. Generally TNF expresses in cell membrane. Regarding which tissues have TNF expression, here are a few articles citing expression in various tissues:
Blood, Pubmed ID: 15489334
Prostatic carcinoma, Pubmed ID: 8597870, 10205166

Boster Scientific Support

Answered: 2017-07-24

Question

We have observed staining in human leukocyte. Are there any suggestions? Is anti-TNF alpha antibody supposed to stain leukocyte positively?

Verified Customer

Verified customer

Asked: 2017-07-19

Answer

According to literature leukocyte does express TNF. According to Uniprot.org, TNF is expressed in leukocyte, blood, prostatic carcinoma, among other tissues. Regarding which tissues have TNF expression, here are a few articles citing expression in various tissues:
Blood, Pubmed ID: 15489334
Prostatic carcinoma, Pubmed ID: 8597870, 10205166

Boster Scientific Support

Answered: 2017-07-19

Question

I was wanting to use your anti-TNF alpha antibody for IF for mouse prostatic carcinoma on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse prostatic carcinoma identification?

L. Thomas

Verified customer

Asked: 2016-12-01

Answer

It shows on the product datasheet, PA1079 anti-TNF alpha antibody has been validated for IF, IHC-P, ICC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse prostatic carcinoma in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2016-12-01

Question

Is this PA1079 anti-TNF alpha antibody reactive to the isotypes of TNF?

M. Edwards

Verified customer

Asked: 2015-06-18

Answer

The immunogen of PA1079 anti-TNF alpha antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human TNF(201-233aa QLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL), different from the related mouse sequence by five amino acids, and rat sequence by seven amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2015-06-18

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for prostatic carcinoma using anti-TNF alpha antibody PA1079. Let me know if you need anything else.

A. Collins

Verified customer

Asked: 2015-02-18

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2015-02-18

Question

Does anti-TNF alpha antibody PA1079 work for IF with prostatic carcinoma?

E. Anderson

Verified customer

Asked: 2014-03-05

Answer

According to the expression profile of prostatic carcinoma, TNF is highly expressed in prostatic carcinoma. So, it is likely that anti-TNF alpha antibody PA1079 will work for IF with prostatic carcinoma.

Boster Scientific Support

Answered: 2014-03-05

Question

Would PA1079 anti-TNF alpha antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

K. Collins

Verified customer

Asked: 2013-07-12

Answer

It shows on the product datasheet, PA1079 anti-TNF alpha antibody as been validated on IF. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2013-07-12

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
PA1079
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$280.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.