Anti-COX2/Cyclooxygenase 2/PTGS2 Antibody Picoband™

COX-2 antibody

Boster Bio Anti-COX2/Cyclooxygenase 2/PTGS2 Antibody Picoband™ catalog # A00084. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. Cited in 10 publication(s).

Product Info Summary

SKU: A00084
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Customers Who Bought This Also Bought

Product Name

Anti-COX2/Cyclooxygenase 2/PTGS2 Antibody Picoband™

View all COX-2 Antibodies

SKU/Catalog Number

A00084

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-COX2/Cyclooxygenase 2/PTGS2 Antibody Picoband™ catalog # A00084. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-COX2/Cyclooxygenase 2/PTGS2 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00084)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human PTGS2 (365-397aa AEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNN), different from the related mouse and rat sequences by eight amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A00084 is reactive to PTGS2 in Human, Mouse, Rat

Applications

A00084 is guaranteed for WB Boster Guarantee

Background of COX-2

Cyclooxygenase (Cox) is the key enzyme in conversion of arachidonic acid to PGs, and two isoforms, Cox-1 and Cox-2, have been identified. Cox-2 gene encodes an inducible prostaglandin synthase enzyme that is overexpressed in adenocarcinomas and other tumors. Deletion of the murine Cox-2 gene in Min mice reduced the incidence of intestinal tumors, suggesting that it is required for tumorigenesis. This gene is localized to sites associated with retinal blood vessels, and plays an important role in blood vessel formation in the retina. And the glucocorticoid receptor suppression of COX-2 is also crucial for curtailing lethal immune activation, and suggests new therapeutic approaches for regulation of T-cell-mediated inflammatory diseases.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat

Validation Images & Assay Conditions

Gene/Protein Information For PTGS2 (Source: Uniprot.org, NCBI)

Uniprot ID

P35354

Gene ID

5743

Gene Name

PTGS2

Full Name

Prostaglandin G/H synthase 2

Weight

68.996kDa

Superfamily

prostaglandin G/H synthase family

Alternative Names

COX2; COX-2; COX2cyclooxygenase 2b; cyclooxygenase-2; EC 1.14.99; EC 1.14.99.1; GRIPGHS; hCox-2; PGG/HS; PGH synthase 2; PGHS-2; PHS II; PHS-2; PHS-II; prostaglandin G/H synthase 2; prostaglandin G/H synthase and cyclooxygenase; Prostaglandin H2 synthase 2; prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase andcyclooxygenase); Prostaglandin-endoperoxide synthase 2; PTGS2 PTGS2 COX-2, COX2, GRIPGHS, PGG/HS, PGHS-2, PHS-2, hCox-2 prostaglandin-endoperoxide synthase 2 prostaglandin G/H synthase 2|PGH synthase 2|PHS II|cyclooxygenase 2|cyclooxygenase 2b|prostaglandin H2 synthase 2|prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase)

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on PTGS2, check out the PTGS2 Infographic

PTGS2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PTGS2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected]

A00084 has been cited in 10 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Effect of astragaloside IV on diabetic gastric mucosa in vivo and in vitro

The Bioactive Alkaloids Identified from Cortex Phellodendri Ameliorate Benign Prostatic Hyperplasia via LOX-5/COX-2 Pathway

Nootkatone protects cartilage against degeneration in mice by inhibiting NF-κB signaling pathway

Zhang ZC,Zhou Q,Yang Y,Wang Y,Zhang JL.Highly Acylated Anthocyanins from Purple Sweet Potato ( Ipomoea batatas L.) Alleviate Hyperuricemia and Kidney Inflammation in Hyperuricemic Mice: Possible Attenuation Effects on Allopurinol. J Agric Food Chem.2019 Jun 5;67(22):6202-6211.doi:10.1021/acs.jafc.9b01810.Epub 2019 May 28.PMID:31091873.
Species: Mouse
A00084 usage in article: APP:WB, SAMPLE:KIDNEY TISSUE, DILUTION:1:200

Yuan L,Li Q,Bai D,Shang X,Hu F,Chen Z,An T,Chen Y,Zhang X.La2O3 Nanoparticles Induce Reproductive Toxicity Mediated by the Nrf-2/ARE Signaling Pathway in Kunming Mice.Int J Nanomedicine.2020 May 14;15:3415-3431.doi:10.2147/IJN.S230949.PMID:32523341;PMCID:PMC7236057.
Species: Mouse
A00084 usage in article: APP:WB, SAMPLE:TESTIS TISSUE, DILUTION:1:400

Chitosan/hyaluronic acid/plasmid-DNA nanoparticles encoding interleukin-1 receptor antagonist attenuate inflammation in synoviocytes induced by %u2026

Induced pluripotent stem cells inhibit bleomycin-induced pulmonary fibrosis in mice through suppressing TGF-%u03B21/Smad-mediated epithelial to mesenchymal %u2026

Combination of fasudil and celecoxib promotes the recovery of injured spinal cord in rats better than celecoxib or fasudil alone

Puerarin protects brain tissue against cerebral ischemia/reperfusion injury by inhibiting the inflammatory response

Effect of cyclooxygenase-2 inhibition on the development of post-traumatic stress disorder in rats

Have you used Anti-COX2/Cyclooxygenase 2/PTGS2 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-COX2/Cyclooxygenase 2/PTGS2 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Anti-COX2/Cyclooxygenase 2/PTGS2 Antibody Picoband™

Size

Conjugation

Total: $315

SKU:A00084

Ask a question

Get A Quote

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

Product Categories

Primary Antibodies

Primary and Secondary Antibodies

Boster Bio offers over 16,000 antibodies that have been validated for IHC, WB, ELISA, and FC in human, mouse, and rat samples. Rabbit and mouse monoclonal antibodies as well as rabbit polyclonal antibodies are available. Buy a primary antibody and get a secondary antibody for free!

ELISA Kits

ELISA Kits

More than 1,000 ELISA kits, both singleplex and multiplex, that have been cited 6,000+ times are available at Boster. We offer our Boster-branded Picokine™ ELISA kits (sandwich ELISA) and EZ-Set™ ELISA kits (DIY antibody pairs) in addition to many multiplex ELISA kits.

Image

Recombinant Proteins

Boster provides a wide range of human, mouse, and rat recombinant proteins, which include cytokines, growth factors, chemokines, and many more. Our recombinant proteins have high stability, biological activity, and purity.

Boster Kit

Reagents

Boster offers all the reagents you need for your immunostaining and western blotting experiments. We've got everything from buffers to lysates to kits, including our popular and well-cited BCA, CCK-8, and MTT assay kits.

In stock
Order Product
A00084
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$315.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.