Anti-RHOB Antibody Picoband™

Boster Bio Anti-RHOB Antibody Picoband™ catalog # A01550-1. Tested in IHC-P, WB applications. This antibody reacts with Human, Monkey.

Product Info Summary

SKU: A01550-1
Size: 100μg/vial
Reactive Species: Human, Monkey
Host: Rabbit
Application: IHC-P, WB

Product Name

Anti-RHOB Antibody Picoband™

See all RHOB products

SKU/Catalog Number







Boster Bio Anti-RHOB Antibody Picoband™ catalog # A01550-1. Tested in IHC-P, WB applications. This antibody reacts with Human, Monkey.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-RHOB Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01550-1)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence of human RHOB (NKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLE).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A01550-1 is reactive to RHOB in Human, Monkey


A01550-1 is guaranteed for IHC-P, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Monkey
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human

Validation Images & Assay Conditions

Gene/Protein Information For RHOB (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Rho-related GTP-binding protein RhoB




small GTPase superfamily

Alternative Names

ARH6MSTP081; ARHBAplysia RAS-related homolog 6; h6; MST081; oncogene RHO H6; ras homolog gene family, member B; Rho cDNA clone 6; RHOH6RhoB; rho-related GTP-binding protein RhoB RHOB ARH6, ARHB, MST081, MSTP081, RHOH6 ras homolog family member B rho-related GTP-binding protein RhoB|Aplysia RAS-related homolog 6|h6|oncogene RHO H6|ras homolog gene family, member B|rho cDNA clone 6

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on RHOB, check out the RHOB Infographic

RHOB infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for RHOB: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A01550-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-RHOB Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-RHOB Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

3 Customer Q&As for Anti-RHOB Antibody Picoband™


We are currently using anti-RHOB antibody A01550-1 for monkey tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human, monkey. Is it possible that the antibody can work on bovine tissues as well?

Verified Customer

Verified customer

Asked: 2019-12-02


The anti-RHOB antibody (A01550-1) has not been validated for cross reactivity specifically with bovine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-12-02


My question regarding product A01550-1, anti-RHOB antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-09-25


It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A01550-1 anti-RHOB antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-09-25


I see that the anti-RHOB antibody A01550-1 works with IHC-P, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-05-20


You can find protocols for IHC-P on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-05-20


Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.