Overview
Product Name |
Anti-RPS6 Antibody Picoband™
See more Ribosomal Protein S6/RPS6 products |
Catalog# |
A01567-1 |
Pack Size |
100μg/vial |
Storage & Handling |
Store at -20°C for one year. For short term storage and frequent use, store at 4°C for up to one month. Avoid repeated freeze-thaw cycles. |
Description |
Boster Bio Anti-RPS6 Antibody Picoband™ catalog # A01567-1. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. Supplied as 100μg/vial in Lyophilized form antibody. |
Cite This Product |
Anti-RPS6 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01567-1)
|
Antibodies Validation |
Antibodies Validation Information
|
Product Specs
Host |
Rabbit |
Reactive Species |
Human, Mouse, Rat |
Applications |
IHC, WB
*Our Boster Guarantee covers the use of this product in the above
tested applications.
*Innovating Scientists reward: if you test this antibody on a species or application not listed above and share with us your results, we will provide you a full credit to purchase Boster products. |
Related Products |
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
*Blocking peptide can be purchased at $100. Contact us for more information.
**Boster also offers various secondary antibodies for Immunoflourescecne and IHC. Take advantage of the buy 1 primary antibody get 1 secondary antibody for free promotion all year round. |
Immunogen |
A synthetic peptide corresponding to a sequence at the N-terminus of human RPS6 (13-52aa QKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRI), identical to the related mouse and rat sequences. |
Cross Reactivity |
No cross reactivity with other proteins. |
Gene/Protein Basic Information For RPS6 (Source: Uniprot.org, NCBI)
Uniprot Id | P62753 |
---|
NCBI Gene Id | 6194 |
---|
Species Of This Entry | Human |
---|
Gene Name | RPS6 |
---|
Protein Name | 40S ribosomal protein S6 |
---|
Superfamily | eukaryotic ribosomal protein eS6 family |
---|
Alternative Names | Ribosomal Protein S6/RPS6|Phosphoprotein NP33, 40S ribosomal protein S6; pS6; Ribosomal Protein S6; RPS6; S6 |
---|
Molecular Weight | 28681 |
---|
*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".
For more info on RPS6, check out the RPS6 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
Want a nice infographic on your next protein? Boster's got them all. All proteins in the human genome, and some, can be found in the Boster Bio gene infographics. Download it and share it with your colleagues and friends. Big size posters available upon request.
In this infographic you will see the following information for RPS6: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. Some times it even contains some opt-ed articles the Boster team on the scientific news and clinical impacts of this protein, though not all have that. Too many proteins, you know.
Take me to the RPS6 infographic
Our Boster Quality Guarantee for Anti-RPS6 Antibody Picoband™ covers its use in the following applications.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Rat, By Heat
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
*The recommended dilution ratios/concentrations are for reference only and optimal dilutions/concentrations should be determined by the end user.

Figure 1. Western blot analysis of RPS6 using anti-RPS6 antibody (A01567-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat testis tissue lysates,
Lane 2: mouse testis tissue lysates,
Lane 3: MCF-7 whole Cell lysates,
Lane 4: A549 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-RPS6 antigen affinity purified polyclonal antibody (Catalog # A01567-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for RPS6 at approximately 32KD. The expected band size for RPS6 is at 29KD.
Figure 2. IHC analysis of RPS6 using anti-RPS6 antibody (A01567-1).
RPS6 was detected in paraffin-embedded section of rat brain tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-RPS6 Antibody (A01567-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Figure 4. IHC analysis of RPS6 using anti-RPS6 antibody (A01567-1).
RPS6 was detected in paraffin-embedded section of human intestinal cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-RPS6 Antibody (A01567-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Figure 5. IHC analysis of RPS6 using anti-RPS6 antibody (A01567-1).
RPS6 was detected in paraffin-embedded section of human lung cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-RPS6 Antibody (A01567-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Figure 3. IHC analysis of RPS6 using anti-RPS6 antibody (A01567-1).
RPS6 was detected in paraffin-embedded section of rat kidney tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-RPS6 Antibody (A01567-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Specific Protocols
Boster provides comprehensive technical information for WB, IHC/IF/ICC, Flow Cytometry sample preparation protocols, assay protocols, troubleshooting tips and assay optimization tips.
Did You Know ?
That Boster Bio offers comprehensive selection of Western blot and IHC reagents? Great quality and save up to 50% cost.
Other Recommended Resources
Here are featured tools and databases that you might find useful.
Total number of citations: 0
|
0 reviews
Contact us with any questions at [email protected] or go to contact us
Questions and answers from customers related to A01567-1 Anti-RPS6 Antibody Picoband™
15 Related Questions
Question
We are currently using anti-RPS6 antibody A01567-1 for rat tissue, and we are content with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on zebrafish tissues as well?
Verified Customer
Asked: 2020-02-26
Answer
The anti-RPS6 antibody (A01567-1) has not been tested for cross reactivity specifically with zebrafish tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-02-26
Question
Is this A01567-1 anti-RPS6 antibody reactive to the isotypes of RPS6?
Verified Customer
Asked: 2019-12-10
Answer
The immunogen of A01567-1 anti-RPS6 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human RPS6 (13-52aa QKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRI), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-12-10
Question
Our lab used your anti-RPS6 antibody for WB on cervix carcinoma erythroleukemia in a previous experiment. I am using mouse, and We want to use the antibody for IHC next. We are interested in examining cervix carcinoma erythroleukemia as well as skin testis in our next experiment. Do you have any suggestion on which antibody would work the best for IHC?
Verified Customer
Asked: 2019-11-22
Answer
I looked at the website and datasheets of our anti-RPS6 antibody and it seems that A01567-1 has been tested on mouse in both WB and IHC. Thus A01567-1 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC in mouse even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2019-11-22
Question
I was wanting to use your anti-RPS6 antibody for IHC for mouse connective tissue on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse connective tissue identification?
Verified Customer
Asked: 2019-09-30
Answer
As indicated on the product datasheet, A01567-1 anti-RPS6 antibody has been validated for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse connective tissue in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-09-30
Question
Does A01567-1 anti-RPS6 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Asked: 2019-09-13
Answer
It shows on the product datasheet, A01567-1 anti-RPS6 antibody as been tested on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-09-13
Question
Please see the WB image, lot number and protocol we used for connective tissue using anti-RPS6 antibody A01567-1. Please let me know if you require anything else.
Verified Customer
Asked: 2019-07-03
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-07-03
Question
Is a blocking peptide available for product anti-RPS6 antibody (A01567-1)?
C. Moore
Asked: 2019-01-09
Answer
We do provide the blocking peptide for product anti-RPS6 antibody (A01567-1). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-01-09
Question
Does anti-RPS6 antibody A01567-1 work for IHC with connective tissue?
Verified Customer
Asked: 2018-12-11
Answer
According to the expression profile of connective tissue, RPS6 is highly expressed in connective tissue. So, it is likely that anti-RPS6 antibody A01567-1 will work for IHC with connective tissue.
Boster Scientific Support
Answered: 2018-12-11
Question
Is there a BSA free version of anti-RPS6 antibody A01567-1 available?
M. Moore
Asked: 2018-04-09
Answer
I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-RPS6 antibody A01567-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2018-04-09
Question
We are interested in to test anti-RPS6 antibody A01567-1 on mouse connective tissue for research purposes, then I may be interested in using anti-RPS6 antibody A01567-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Asked: 2018-02-01
Answer
The products we sell, including anti-RPS6 antibody A01567-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2018-02-01
Question
I have a question about product A01567-1, anti-RPS6 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Asked: 2017-08-30
Answer
It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A01567-1 anti-RPS6 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2017-08-30
Question
We have seen staining in rat pancreas. Do you have any suggestions? Is anti-RPS6 antibody supposed to stain pancreas positively?
Verified Customer
Asked: 2017-05-11
Answer
Based on literature pancreas does express RPS6. Based on Uniprot.org, RPS6 is expressed in connective tissue, colon adenocarcinoma, colon, muscle, pancreas, skin testis, placenta, cervix carcinoma, cervix carcinoma erythroleukemia, liver, among other tissues. Regarding which tissues have RPS6 expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 17081983, 18669648, 18691976, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Colon, Muscle, Pancreas, Skin, and Testis, Pubmed ID: 15489334
Liver, Pubmed ID: 24275569
Placenta, Pubmed ID: 8706699
Boster Scientific Support
Answered: 2017-05-11
Question
Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for connective tissue using anti-RPS6 antibody A01567-1. Let me know if you need anything else.
Answer
Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2016-11-08
Question
We need using your anti-RPS6 antibody for and subsequently studies. Has this antibody been tested with western blotting on testis tissue? We would like to see some validation images before ordering.
O. Lewis
Asked: 2014-07-07
Answer
We appreciate your inquiry. This A01567-1 anti-RPS6 antibody is tested on rat kidney, testis tissue, mouse testis tissue, a549 whole cell lysates. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2014-07-07
Question
I see that the anti-RPS6 antibody A01567-1 works with IHC, what is the protocol used to produce the result images on the product page?
L. Brown
Asked: 2013-07-03
Answer
You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2013-07-03