Anti-RPS6 Antibody Picoband™

Boster Bio Anti-RPS6 Antibody Picoband™ catalog # A01567-1. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A01567-1
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Product Name

Anti-RPS6 Antibody Picoband™

See all Ribosomal Protein S6/RPS6 products

SKU/Catalog Number

A01567-1

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-RPS6 Antibody Picoband™ catalog # A01567-1. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-RPS6 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01567-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human RPS6 (13-52aa QKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRI), identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A01567-1 is reactive to RPS6 in Human, Mouse, Rat

Applications

A01567-1 is guaranteed for IHC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Rat, By Heat
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat

Validation Images & Assay Conditions

Gene/Protein Information For RPS6 (Source: Uniprot.Org, NCBI)

Uniprot ID

P62753

Gene ID

6194

Gene Name

RPS6

Full Name

40S ribosomal protein S6

Weight

28.681kDa

Superfamily

eukaryotic ribosomal protein eS6 family

Alternative Names

Phosphoprotein NP33, 40S ribosomal protein S6; pS6; Ribosomal Protein S6; RPS6; S6 RPS6 S6 ribosomal protein S6 40S ribosomal protein S6|phosphoprotein NP33|small ribosomal subunit protein eS6

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on RPS6, check out the RPS6 Infographic

RPS6 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for RPS6: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A01567-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-RPS6 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-RPS6 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

15 Customer Q&As for Anti-RPS6 Antibody Picoband™

Question

We are currently using anti-RPS6 antibody A01567-1 for rat tissue, and we are content with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on zebrafish tissues as well?

Verified Customer

Verified customer

Asked: 2020-02-26

Answer

The anti-RPS6 antibody (A01567-1) has not been tested for cross reactivity specifically with zebrafish tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-02-26

Question

Is this A01567-1 anti-RPS6 antibody reactive to the isotypes of RPS6?

Verified Customer

Verified customer

Asked: 2019-12-10

Answer

The immunogen of A01567-1 anti-RPS6 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human RPS6 (13-52aa QKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRI), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-12-10

Question

Our lab used your anti-RPS6 antibody for WB on cervix carcinoma erythroleukemia in a previous experiment. I am using mouse, and We want to use the antibody for IHC next. We are interested in examining cervix carcinoma erythroleukemia as well as skin testis in our next experiment. Do you have any suggestion on which antibody would work the best for IHC?

Verified Customer

Verified customer

Asked: 2019-11-22

Answer

I looked at the website and datasheets of our anti-RPS6 antibody and it seems that A01567-1 has been tested on mouse in both WB and IHC. Thus A01567-1 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC in mouse even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2019-11-22

Question

I was wanting to use your anti-RPS6 antibody for IHC for mouse connective tissue on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse connective tissue identification?

Verified Customer

Verified customer

Asked: 2019-09-30

Answer

As indicated on the product datasheet, A01567-1 anti-RPS6 antibody has been validated for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse connective tissue in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-09-30

Question

Does A01567-1 anti-RPS6 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2019-09-13

Answer

It shows on the product datasheet, A01567-1 anti-RPS6 antibody as been tested on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-09-13

Question

Please see the WB image, lot number and protocol we used for connective tissue using anti-RPS6 antibody A01567-1. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-07-03

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-07-03

Question

Is a blocking peptide available for product anti-RPS6 antibody (A01567-1)?

C. Moore

Verified customer

Asked: 2019-01-09

Answer

We do provide the blocking peptide for product anti-RPS6 antibody (A01567-1). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-01-09

Question

Does anti-RPS6 antibody A01567-1 work for IHC with connective tissue?

Verified Customer

Verified customer

Asked: 2018-12-11

Answer

According to the expression profile of connective tissue, RPS6 is highly expressed in connective tissue. So, it is likely that anti-RPS6 antibody A01567-1 will work for IHC with connective tissue.

Boster Scientific Support

Answered: 2018-12-11

Question

Is there a BSA free version of anti-RPS6 antibody A01567-1 available?

M. Moore

Verified customer

Asked: 2018-04-09

Answer

I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-RPS6 antibody A01567-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2018-04-09

Question

We are interested in to test anti-RPS6 antibody A01567-1 on mouse connective tissue for research purposes, then I may be interested in using anti-RPS6 antibody A01567-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2018-02-01

Answer

The products we sell, including anti-RPS6 antibody A01567-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2018-02-01

Question

I have a question about product A01567-1, anti-RPS6 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2017-08-30

Answer

It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A01567-1 anti-RPS6 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2017-08-30

Question

We have seen staining in rat pancreas. Do you have any suggestions? Is anti-RPS6 antibody supposed to stain pancreas positively?

Verified Customer

Verified customer

Asked: 2017-05-11

Answer

Based on literature pancreas does express RPS6. Based on Uniprot.org, RPS6 is expressed in connective tissue, colon adenocarcinoma, colon, muscle, pancreas, skin testis, placenta, cervix carcinoma, cervix carcinoma erythroleukemia, liver, among other tissues. Regarding which tissues have RPS6 expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 17081983, 18669648, 18691976, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Colon, Muscle, Pancreas, Skin, and Testis, Pubmed ID: 15489334
Liver, Pubmed ID: 24275569
Placenta, Pubmed ID: 8706699

Boster Scientific Support

Answered: 2017-05-11

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for connective tissue using anti-RPS6 antibody A01567-1. Let me know if you need anything else.

B. Li

Verified customer

Asked: 2016-11-08

Answer

Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2016-11-08

Question

We need using your anti-RPS6 antibody for and subsequently studies. Has this antibody been tested with western blotting on testis tissue? We would like to see some validation images before ordering.

O. Lewis

Verified customer

Asked: 2014-07-07

Answer

We appreciate your inquiry. This A01567-1 anti-RPS6 antibody is tested on rat kidney, testis tissue, mouse testis tissue, a549 whole cell lysates. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2014-07-07

Question

I see that the anti-RPS6 antibody A01567-1 works with IHC, what is the protocol used to produce the result images on the product page?

L. Brown

Verified customer

Asked: 2013-07-03

Answer

You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2013-07-03

Conjugation

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
A01567-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$280.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.