Product Info Summary
SKU: | M01567 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Mouse |
Application: | Flow Cytometry, IF, IHC, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-RPS6 Antibody Picoband™ (monoclonal, 2H7)
View all Ribosomal Protein S6/RPS6 Antibodies
SKU/Catalog Number
M01567
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-RPS6 Antibody Picoband™ (monoclonal, 2H7) catalog # M01567. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-RPS6 Antibody Picoband™ (monoclonal, 2H7) (Boster Biological Technology, Pleasanton CA, USA, Catalog # M01567)
Host
Mouse
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Monoclonal
Clone Number
2H7
Isotype
Mouse IgG1
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human RPS6, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
M01567 is reactive to RPS6 in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500μg/ml.
Observed Molecular Weight
29 kDa
Calculated molecular weight
Background of Ribosomal Protein S6/RPS6
Ribosomal protein S6 (rpS6) is a component of the 40S ribosomal subunit and is therefore thought to be involved in regulating translation. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a cytoplasmic ribosomal protein that is a component of the 40S subunit. The protein belongs to the S6E family of ribosomal proteins. It is the major substrate of protein kinases in the ribosome, with subsets of five C-terminal serine residues phosphorylated by different protein kinases. Phosphorylation is induced by a wide range of stimuli, including growth factors, tumor-promoting agents, and mitogens. Dephosphorylation occurs at growth arrest. The protein may contribute to the control of cell growth and proliferation through the selective translation of particular classes of mRNA. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. While the true function of rpS6 is currently under investigation, studies have shown that it is involved in the regulation of cell size, cell proliferation, and glucose homeostasis.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
M01567 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Immunocytochemistry/Immunofluorescence, 2μg/ml
Flow Cytometry (Fixed), 1-3μg/1x106 cells
Positive Control
Validation Images & Assay Conditions
![m01567 rps6 primary antibodies if testing 1 m01567 rps6 primary antibodies if testing 1](https://www.bosterbio.com/media/catalog/product/m/0/m01567-rps6-primary-antibodies-if-testing-1.jpg)
Click image to see more details
Figure 1. IF analysis of RPS6 using anti-RPS6 antibody (M01567)
RPS6 was detected in paraffin-embedded section of rat brain tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/mL mouse anti-RPS6 Antibody (M01567) overnight at 4°C. Biotin conjugated goat anti-mouse IgG (BA1001) was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using DyLight488 Conjugated Avidin (BA1128). The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Protein Target Info & Infographic
Gene/Protein Information For RPS6 (Source: Uniprot.org, NCBI)
Gene Name
RPS6
Full Name
40S ribosomal protein S6
Weight
Superfamily
eukaryotic ribosomal protein eS6 family
Alternative Names
Phosphoprotein NP33, 40S ribosomal protein S6; pS6; Ribosomal Protein S6; RPS6; S6 RPS6 S6 ribosomal protein S6 40S ribosomal protein S6|phosphoprotein NP33|small ribosomal subunit protein eS6
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on RPS6, check out the RPS6 Infographic
![RPS6 infographic](/media/images/gene-infographic-example.jpg)
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for RPS6: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-RPS6 Antibody Picoband™ (monoclonal, 2H7) (M01567)
Hello CJ!
No publications found for M01567
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-RPS6 Antibody Picoband™ (monoclonal, 2H7)?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-RPS6 Antibody Picoband™ (monoclonal, 2H7)
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
14 Customer Q&As for Anti-RPS6 Antibody Picoband™ (monoclonal, 2H7)
Question
Our lab want to know about to test anti-RPS6 antibody (monoclonal, 2H7) M01567 on mouse connective tissue for research purposes, then I may be interested in using anti-RPS6 antibody (monoclonal, 2H7) M01567 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2020-04-23
Answer
The products we sell, including anti-RPS6 antibody (monoclonal, 2H7) M01567, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2020-04-23
Question
I have attached the WB image, lot number and protocol we used for connective tissue using anti-RPS6 antibody (monoclonal, 2H7) M01567. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2020-02-05
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-02-05
Question
I have a question about product M01567, anti-RPS6 antibody (monoclonal, 2H7). I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2020-01-17
Answer
We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free M01567 anti-RPS6 antibody (monoclonal, 2H7), we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2020-01-17
Question
Is this M01567 anti-RPS6 antibody (monoclonal, 2H7) reactive to the isotypes of RPS6?
Verified Customer
Verified customer
Asked: 2019-12-17
Answer
The immunogen of M01567 anti-RPS6 antibody (monoclonal, 2H7) is A synthetic peptide corresponding to a sequence at the N-terminus of human RPS6 (13-52aa QKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRI), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-12-17
Question
Is there a BSA free version of anti-RPS6 antibody (monoclonal, 2H7) M01567 available?
Verified Customer
Verified customer
Asked: 2019-11-04
Answer
Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-RPS6 antibody (monoclonal, 2H7) M01567 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2019-11-04
Question
I was wanting to use your anti-RPS6 antibody (monoclonal, 2H7) for Flow Cytometry for mouse connective tissue on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse connective tissue identification?
Verified Customer
Verified customer
Asked: 2019-10-17
Answer
It shows on the product datasheet, M01567 anti-RPS6 antibody (monoclonal, 2H7) has been tested for Flow Cytometry, IF, IHC-P, ICC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse connective tissue in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-10-17
Question
We have observed staining in rat placenta. Are there any suggestions? Is anti-RPS6 antibody (monoclonal, 2H7) supposed to stain placenta positively?
Verified Customer
Verified customer
Asked: 2019-09-27
Answer
According to literature placenta does express RPS6. According to Uniprot.org, RPS6 is expressed in connective tissue, colon adenocarcinoma, colon, muscle, pancreas, skin testis, placenta, cervix carcinoma, cervix carcinoma erythroleukemia, liver, among other tissues. Regarding which tissues have RPS6 expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 17081983, 18669648, 18691976, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Colon, Muscle, Pancreas, Skin, and Testis, Pubmed ID: 15489334
Liver, Pubmed ID: 24275569
Placenta, Pubmed ID: 8706699
Boster Scientific Support
Answered: 2019-09-27
Question
Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for connective tissue using anti-RPS6 antibody (monoclonal, 2H7) M01567. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-08-13
Answer
Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-08-13
Question
I see that the anti-RPS6 antibody (monoclonal, 2H7) M01567 works with Flow Cytometry, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-04-17
Answer
You can find protocols for Flow Cytometry on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-04-17
Question
We are currently using anti-RPS6 antibody (monoclonal, 2H7) M01567 for mouse tissue, and we are satisfied with the IHC-P results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on feline tissues as well?
Verified Customer
Verified customer
Asked: 2019-03-07
Answer
The anti-RPS6 antibody (monoclonal, 2H7) (M01567) has not been validated for cross reactivity specifically with feline tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-03-07
Question
We have tried in the past anti-RPS6 antibody (monoclonal, 2H7) for IHC-P on colon adenocarcinoma last year. I am using mouse, and We want to use the antibody for WB next. I am interested in examining colon adenocarcinoma as well as muscle in our next experiment. Could you please give me some suggestion on which antibody would work the best for WB?
P. Jones
Verified customer
Asked: 2018-07-24
Answer
I looked at the website and datasheets of our anti-RPS6 antibody (monoclonal, 2H7) and I see that M01567 has been validated on mouse in both IHC-P and WB. Thus M01567 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in mouse even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2018-07-24
Question
Is a blocking peptide available for product anti-RPS6 antibody (monoclonal, 2H7) (M01567)?
R. Krishna
Verified customer
Asked: 2018-03-05
Answer
We do provide the blocking peptide for product anti-RPS6 antibody (monoclonal, 2H7) (M01567). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2018-03-05
Question
Will anti-RPS6 antibody (monoclonal, 2H7) M01567 work for Flow Cytometry with connective tissue?
S. Walker
Verified customer
Asked: 2015-03-06
Answer
According to the expression profile of connective tissue, RPS6 is highly expressed in connective tissue. So, it is likely that anti-RPS6 antibody (monoclonal, 2H7) M01567 will work for Flow Cytometry with connective tissue.
Boster Scientific Support
Answered: 2015-03-06
Question
Would M01567 anti-RPS6 antibody (monoclonal, 2H7) work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
K. Huang
Verified customer
Asked: 2013-11-21
Answer
As indicated on the product datasheet, M01567 anti-RPS6 antibody (monoclonal, 2H7) as been validated on Flow Cytometry. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2013-11-21