Anti-RPS6 Antibody Picoband™ (monoclonal, 2H7)

Boster Bio Anti-RPS6 Antibody Picoband™ (monoclonal, 2H7) catalog # M01567. Tested in Flow Cytometry, IF, IHC-P, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: M01567
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Mouse
Application: Flow Cytometry, IF, IHC-P, ICC, WB

Product Name

Anti-RPS6 Antibody Picoband™ (monoclonal, 2H7)

See all Ribosomal Protein S6/RPS6 products

SKU/Catalog Number







Boster Bio Anti-RPS6 Antibody Picoband™ (monoclonal, 2H7) catalog # M01567. Tested in Flow Cytometry, IF, IHC-P, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-RPS6 Antibody Picoband™ (monoclonal, 2H7) (Boster Biological Technology, Pleasanton CA, USA, Catalog # M01567)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.



Clone Number





A synthetic peptide corresponding to a sequence at the N-terminus of human RPS6 (13-52aa QKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRI), identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

M01567 is reactive to RPS6 in Human, Mouse, Rat


M01567 is guaranteed for Flow Cytometry, IF, IHC-P, ICC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500μg/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Immunocytochemistry/Immunofluorescence, 2μg/ml
Flow Cytometry, 1-3μg/1x106 cells

Validation Images & Assay Conditions

Gene/Protein Information For RPS6 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

40S ribosomal protein S6




eukaryotic ribosomal protein eS6 family

Alternative Names

Phosphoprotein NP33, 40S ribosomal protein S6; pS6; Ribosomal Protein S6; RPS6; S6 RPS6 S6 ribosomal protein S6 40S ribosomal protein S6|phosphoprotein NP33|small ribosomal subunit protein eS6

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on RPS6, check out the RPS6 Infographic

RPS6 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for RPS6: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for M01567

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-RPS6 Antibody Picoband™ (monoclonal, 2H7)?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-RPS6 Antibody Picoband™ (monoclonal, 2H7)

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

14 Customer Q&As for Anti-RPS6 Antibody Picoband™ (monoclonal, 2H7)


Our lab want to know about to test anti-RPS6 antibody (monoclonal, 2H7) M01567 on mouse connective tissue for research purposes, then I may be interested in using anti-RPS6 antibody (monoclonal, 2H7) M01567 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2020-04-23


The products we sell, including anti-RPS6 antibody (monoclonal, 2H7) M01567, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2020-04-23


I have attached the WB image, lot number and protocol we used for connective tissue using anti-RPS6 antibody (monoclonal, 2H7) M01567. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2020-02-05


Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-02-05


I have a question about product M01567, anti-RPS6 antibody (monoclonal, 2H7). I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2020-01-17


We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free M01567 anti-RPS6 antibody (monoclonal, 2H7), we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2020-01-17


Is this M01567 anti-RPS6 antibody (monoclonal, 2H7) reactive to the isotypes of RPS6?

Verified Customer

Verified customer

Asked: 2019-12-17


The immunogen of M01567 anti-RPS6 antibody (monoclonal, 2H7) is A synthetic peptide corresponding to a sequence at the N-terminus of human RPS6 (13-52aa QKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRI), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-12-17


Is there a BSA free version of anti-RPS6 antibody (monoclonal, 2H7) M01567 available?

Verified Customer

Verified customer

Asked: 2019-11-04


Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-RPS6 antibody (monoclonal, 2H7) M01567 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-11-04


I was wanting to use your anti-RPS6 antibody (monoclonal, 2H7) for Flow Cytometry for mouse connective tissue on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse connective tissue identification?

Verified Customer

Verified customer

Asked: 2019-10-17


It shows on the product datasheet, M01567 anti-RPS6 antibody (monoclonal, 2H7) has been tested for Flow Cytometry, IF, IHC-P, ICC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse connective tissue in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-10-17


We have observed staining in rat placenta. Are there any suggestions? Is anti-RPS6 antibody (monoclonal, 2H7) supposed to stain placenta positively?

Verified Customer

Verified customer

Asked: 2019-09-27


According to literature placenta does express RPS6. According to, RPS6 is expressed in connective tissue, colon adenocarcinoma, colon, muscle, pancreas, skin testis, placenta, cervix carcinoma, cervix carcinoma erythroleukemia, liver, among other tissues. Regarding which tissues have RPS6 expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 17081983, 18669648, 18691976, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Colon, Muscle, Pancreas, Skin, and Testis, Pubmed ID: 15489334
Liver, Pubmed ID: 24275569
Placenta, Pubmed ID: 8706699

Boster Scientific Support

Answered: 2019-09-27


Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for connective tissue using anti-RPS6 antibody (monoclonal, 2H7) M01567. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-08-13


Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-08-13


I see that the anti-RPS6 antibody (monoclonal, 2H7) M01567 works with Flow Cytometry, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-04-17


You can find protocols for Flow Cytometry on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-04-17


We are currently using anti-RPS6 antibody (monoclonal, 2H7) M01567 for mouse tissue, and we are satisfied with the IHC-P results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on feline tissues as well?

Verified Customer

Verified customer

Asked: 2019-03-07


The anti-RPS6 antibody (monoclonal, 2H7) (M01567) has not been validated for cross reactivity specifically with feline tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-03-07


We have tried in the past anti-RPS6 antibody (monoclonal, 2H7) for IHC-P on colon adenocarcinoma last year. I am using mouse, and We want to use the antibody for WB next. I am interested in examining colon adenocarcinoma as well as muscle in our next experiment. Could you please give me some suggestion on which antibody would work the best for WB?

P. Jones

Verified customer

Asked: 2018-07-24


I looked at the website and datasheets of our anti-RPS6 antibody (monoclonal, 2H7) and I see that M01567 has been validated on mouse in both IHC-P and WB. Thus M01567 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in mouse even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website to find out more information about them.

Boster Scientific Support

Answered: 2018-07-24


Is a blocking peptide available for product anti-RPS6 antibody (monoclonal, 2H7) (M01567)?

R. Krishna

Verified customer

Asked: 2018-03-05


We do provide the blocking peptide for product anti-RPS6 antibody (monoclonal, 2H7) (M01567). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2018-03-05


Will anti-RPS6 antibody (monoclonal, 2H7) M01567 work for Flow Cytometry with connective tissue?

S. Walker

Verified customer

Asked: 2015-03-06


According to the expression profile of connective tissue, RPS6 is highly expressed in connective tissue. So, it is likely that anti-RPS6 antibody (monoclonal, 2H7) M01567 will work for Flow Cytometry with connective tissue.

Boster Scientific Support

Answered: 2015-03-06


Would M01567 anti-RPS6 antibody (monoclonal, 2H7) work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

K. Huang

Verified customer

Asked: 2013-11-21


As indicated on the product datasheet, M01567 anti-RPS6 antibody (monoclonal, 2H7) as been validated on Flow Cytometry. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2013-11-21


Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.