Anti-SKP2 Antibody Picoband™

Boster Bio Anti-SKP2 Antibody Picoband™ catalog # A00544. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. Cited in 4 publication(s).

Product Info Summary

SKU: A00544
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Product Name

Anti-SKP2 Antibody Picoband™

See all SKP2 products

SKU/Catalog Number







Boster Bio Anti-SKP2 Antibody Picoband™ catalog # A00544. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-SKP2 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00544)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence of human SKP2 (ETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHL).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A00544 is reactive to SKP2 in Human, Mouse, Rat


A00544 is guaranteed for WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml

Validation Images & Assay Conditions

Gene/Protein Information For SKP2 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

S-phase kinase-associated protein 2



Alternative Names

CDK2/cyclin A-associated protein p45; cyclin A/CDK2-associated protein p45; Cyclin-A/CDK2-associated protein p45; FBL1; F-box protein Skp2; F-box/LRR-repeat protein 1; FBXL1; FBXL1MGC1366; FLB1; p45skp2; Skp2; S-phase kinase-associated protein 2 (p45); S-phase kinase-associated protein 2 SKP2 FBL1, FBXL1, FLB1, p45 S-phase kinase associated protein 2 S-phase kinase-associated protein 2|CDK2/cyclin A-associated protein p45|F-box/LRR-repeat protein 1|S-phase kinase-associated protein 2, E3 ubiquitin protein ligase|p45skp2

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on SKP2, check out the SKP2 Infographic

SKP2 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for SKP2: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

A00544 has been cited in 4 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Xu F, Zhu X, Han T, You X, Liu F, Ye L, Zhang X, Wang X, Yao Y. Int J Oncol. 2014 Jul;45(1):255-63. Doi: 10.3892/Ijo.2014.2411. Epub 2014 Apr 29. The Oncoprotein Hepatitis B X-Interacting Protein Promotes The Migration Of Ovarian Cancer Cells Thro...

Su Y, Wang F, Qi H, Zhao Sg, Li X, Cui H. Mol Vis. 2011 Jan 22;17:247-56. Small Interfering Rna Targeting Of S Phase Kinase-Interacting Protein 2 Inhibits Cell Proliferation Of Pterygium Fibroblasts.

Chen Xm, Xie Xb, Zhao Q, Wang F, Bai Y, Yin Jq, Jiang H, Xie Xl, Jia Q, Huang G. Mol Med Rep. 2015 Jan;11(1):105-12. Doi: 10.3892/Mmr.2014.2733. Epub 2014 Oct 21. Ampelopsin Induces Apoptosis By Regulating Multiple C-Myc/S-Phase Kinase-Associated ...

Chen Xm, Bai Y, Zhong Yj, Xie Xl, Long Hw, Yang Yy, Wu Sg, Jia Q, Wang Xh. Plos One. 2013 Nov 12;8(11):E79201. Doi: 10.1371/Journal.Pone.0079201. Ecollection 2013. Wogonin Has Multiple Anti-Cancer Effects By Regulating C-Myc/Skp2/Fbw7?? And Hdac1/...

Have you used Anti-SKP2 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-SKP2 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Anti-SKP2 Antibody Picoband™


Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.