Anti-STAT6 Antibody Picoband™

STAT6 antibody

Boster Bio Anti-STAT6 Antibody Picoband™ catalog # PB9405. Tested in WB applications. This antibody reacts with Human, Rat. Cited in 2 publication(s).

Product Info Summary

SKU: PB9405
Size: 100 μg/vial
Reactive Species: Human, Rat
Host: Rabbit
Application: WB

Product Name

Anti-STAT6 Antibody Picoband™

View all STAT6 Antibodies

SKU/Catalog Number

PB9405

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-STAT6 Antibody Picoband™ catalog # PB9405. Tested in WB applications. This antibody reacts with Human, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-STAT6 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9405)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human STAT6, different from the related mouse sequence by three amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

PB9405 is reactive to STAT6 in Human, Rat

Applications

PB9405 is guaranteed for WB Boster Guarantee

Observed Molecular Weight

94 kDa

Calculated molecular weight

94.135kDa

Background of STAT6

STAT6 is a human gene. The protein encoded by this gene is a member of the STAT family of transcription factors. The gene spans 19 kb and contains 23 exons. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X (L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2), expression of cell surface markers, and class switch of immunoglobulins.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Rat, Human

Validation Images & Assay Conditions

Gene/Protein Information For STAT6 (Source: Uniprot.org, NCBI)

Gene Name

STAT6

Full Name

Signal transducer and activator of transcription 6

Weight

94.135kDa

Superfamily

transcription factor STAT family

Alternative Names

D12S1644; EC 2.4.1.227; EC 2.7.7.6; IL-4 Stat; IL-4-STAT; signal transducer and activator of transcription 6; signal transducer and activator of transcription 6, interleukin-4 induced; STAT, interleukin-4 induced; STAT, interleukin4-induced; STAT6; STAT6B; STAT6C; transcription factor IL-4 STAT STAT6 D12S1644, IL-4-STATB, STAT6C, STAT6 signal transducer and activator of transcription 6 signal transducer and activator of transcription 6|STAT, interleukin4-induced|signal transducer and activator of transcription 6, interleukin-4 induced|transcription factor IL-4 STAT

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on STAT6, check out the STAT6 Infographic

STAT6 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for STAT6: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

PB9405 has been cited in 2 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Hydrogen sulfide attenuates myocardial fibrosis in diabetic rats through the JAK/STAT signaling pathway

Li Z, Guan Yq, Liu Jm. Biomaterials. 2014 Jun;35(18):5016-27. Doi: 10.1016/J.Biomaterials.2014.03.004. Epub 2014 Mar 25. The Role Of Stat-6 As A Key Transcription Regulator In Hela Cell Death Induced By Ifn-??/Tnf-?? Co-Immobilized On Nanoparticles.

Have you used Anti-STAT6 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Anti-STAT6 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

15 Customer Q&As for Anti-STAT6 Antibody Picoband™

Question

Would anti-STAT6 antibody PB9405 work for WB with uterus?

Verified Customer

Verified customer

Asked: 2020-04-14

Answer

According to the expression profile of uterus, STAT6 is highly expressed in uterus. So, it is likely that anti-STAT6 antibody PB9405 will work for WB with uterus.

Boster Scientific Support

Answered: 2020-04-14

Question

you antibody using your anti-STAT6 antibody for interleukin-4 and interleukin-13 signaling studies. Has this antibody been tested with western blotting on tissue lysate? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2019-12-12

Answer

We appreciate your inquiry. This PB9405 anti-STAT6 antibody is validated on rat brain tissue, tissue lysate. It is guaranteed to work for WB in human, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2019-12-12

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for uterus using anti-STAT6 antibody PB9405. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-10-29

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-10-29

Question

Is a blocking peptide available for product anti-STAT6 antibody (PB9405)?

Verified Customer

Verified customer

Asked: 2019-09-16

Answer

We do provide the blocking peptide for product anti-STAT6 antibody (PB9405). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-09-16

Question

I see that the anti-STAT6 antibody PB9405 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-09-10

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-09-10

Question

Here is the WB image, lot number and protocol we used for uterus using anti-STAT6 antibody PB9405. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-08-27

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-08-27

Question

My team were content with the WB result of your anti-STAT6 antibody. However we have been able to see positive staining in esophagus cytoplasm. nucleus. note=translocated into using this antibody. Is that expected? Could you tell me where is STAT6 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2019-06-11

Answer

According to literature, esophagus does express STAT6. Generally STAT6 expresses in cytoplasm. nucleus. note=translocated into. Regarding which tissues have STAT6 expression, here are a few articles citing expression in various tissues:
Tongue, Pubmed ID: 14702039
Uterus, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2019-06-11

Question

Will PB9405 anti-STAT6 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2019-05-22

Answer

You can see on the product datasheet, PB9405 anti-STAT6 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-05-22

Question

Can you help my question with product PB9405, anti-STAT6 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-05-15

Answer

We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9405 anti-STAT6 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-05-15

Question

Is this PB9405 anti-STAT6 antibody reactive to the isotypes of STAT6?

Verified Customer

Verified customer

Asked: 2019-04-08

Answer

The immunogen of PB9405 anti-STAT6 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human STAT6(85-115aa ESIYQRDPLKLVATFRQILQGEKKAVMEQFR), different from the related mouse sequence by three amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-04-08

Question

I was wanting to use your anti-STAT6 antibody for WB for rat uterus on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for rat uterus identification?

Verified Customer

Verified customer

Asked: 2018-10-12

Answer

You can see on the product datasheet, PB9405 anti-STAT6 antibody has been validated for WB on human, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat uterus in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2018-10-12

Question

We have been able to see staining in human esophagus. Do you have any suggestions? Is anti-STAT6 antibody supposed to stain esophagus positively?

P. Moore

Verified customer

Asked: 2018-01-04

Answer

According to literature esophagus does express STAT6. According to Uniprot.org, STAT6 is expressed in esophagus, tongue, uterus, among other tissues. Regarding which tissues have STAT6 expression, here are a few articles citing expression in various tissues:
Tongue, Pubmed ID: 14702039
Uterus, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2018-01-04

Question

My lab would like to test anti-STAT6 antibody PB9405 on rat uterus for research purposes, then I may be interested in using anti-STAT6 antibody PB9405 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

E. Singh

Verified customer

Asked: 2017-09-19

Answer

The products we sell, including anti-STAT6 antibody PB9405, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2017-09-19

Question

We are currently using anti-STAT6 antibody PB9405 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human, rat. Is it likely that the antibody can work on monkey tissues as well?

E. Wu

Verified customer

Asked: 2016-07-27

Answer

The anti-STAT6 antibody (PB9405) has not been tested for cross reactivity specifically with monkey tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2016-07-27

Question

Is there a BSA free version of anti-STAT6 antibody PB9405 available?

B. Dhar

Verified customer

Asked: 2014-11-18

Answer

I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-STAT6 antibody PB9405 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2014-11-18

Order DetailsPrice
PB9405

100μg

$370
PB9405-10ug

10μg sample (liquid)

$99
PB9405-Biotin

100 μg Biotin conjugated

$570
PB9405-Cy3

100 μg Cy3 conjugated

$570
PB9405-Dylight488

100 μg Dylight488 conjugated

$570
PB9405-Dylight550

100 μg Dylight550 conjugated

$570
PB9405-Dylight594

100 μg Dylight594 conjugated

$570
PB9405-FITC

100 μg FITC conjugated

$570
PB9405-HRP

100 μg HRP conjugated

$570
PB9405-APC

100 μg APC conjugated

$670
PB9405-PE

100 μg PE conjugated

$670
PB9405-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9405
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.