Anti-Synapsin I/SYN1 Antibody Picoband®

SYN1 antibody

Boster Bio Anti-Synapsin I/SYN1 Antibody Picoband® catalog # PB10099. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 8 publication(s).

Product Info Summary

SKU: PB10099
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Customers Who Bought This Also Bought

Product Name

Anti-Synapsin I/SYN1 Antibody Picoband®

View all SYN1 Antibodies

SKU/Catalog Number

PB10099

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Synapsin I/SYN1 Antibody Picoband® catalog # PB10099. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Synapsin I/SYN1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10099)

Host

Rabbit

Contents

Each vial contains antibody formulated with stabilizing components, 0.9 mg NaCl, 0.2 mg Na2HPO4, and 0.05 mg NaN3.
*This antibody is supplied in a stabilized formulation.
Compatibility with conjugation reactions depends on the chemistry of the conjugation method used.
For conjugation methods that are not compatible with the stabilizing components present in this formulation, a carrier-free antibody format is required.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human Synapsin I, identical to the related mouse and rat sequences.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB10099 is reactive to SYN1 in Human, Mouse, Rat

Observed Molecular Weight

74 kDa

Calculated molecular weight

74.1 kDa

Background of SYN1

Synapsin I, is the collective name for Synapsin Ia and Synapsin Ib, two nearly identical phosphoproteins that in humans are encoded by the SYN1 gene. This gene is a member of the synapsin gene family. Synapsins encode neuronal phosphoproteins which associate with the cytoplasmic surface of synaptic vesicles. Family members are characterized by common protein domains, and they are implicated in synaptogenesis and the modulation of neurotransmitter release, suggesting a potential role in several neuropsychiatric diseases. This member of the synapsin family plays a role in regulation of axonogenesis and synaptogenesis. The protein encoded serves as a substrate for several different protein kinases and phosphorylation may function in the regulation of this protein in the nerve terminal. Mutations in this gene may be associated with X-linked disorders with primary neuronal degeneration such as Rett syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB10099 is guaranteed for IHC, WB Boster Guarantee

Recommend Dilution

ApplicationDilutionSpecies
Immunohistochemistry (Paraffin-embedded Section)0.5-1μg/mlHuman
Western blot0.1-0.5μg/mlHuman, Mouse, Rat

Tested application

Synapsin antibody was positively detected by WB in:
rat brain tissue, mouse brain tissue
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane
Synapsin antibody was positively detected by IHC in:
human glioma tissue
Use TE buffer pH 9.0 for antigen retrieval; (*) citrate buffer pH 6.0 is an alternative.

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-Synapsin I/SYN1 Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-Synapsin I/SYN1 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

16 Customer Q&As for Anti-Synapsin I/SYN1 Antibody Picoband®

Question

Is a blocking peptide available for product anti-Synapsin I/SYN1 antibody (PB10099)?

Verified Customer

Verified customer

Asked: 2020-01-10

Answer

We do provide the blocking peptide for product anti-Synapsin I/SYN1 antibody (PB10099). If you would like to place an order for it please contact support@bosterbio.com and make a special request.

Boster Scientific Support

Answered: 2020-01-10

Question

Please see the WB image, lot number and protocol we used for brain using anti-Synapsin I/SYN1 antibody PB10099. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2020-01-08

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-01-08

Question

Does PB10099 anti-Synapsin I/SYN1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2019-12-19

Answer

It shows on the product datasheet, PB10099 anti-Synapsin I/SYN1 antibody as been validated on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-12-19

Question

My team were content with the WB result of your anti-Synapsin I/SYN1 antibody. However we have observed positive staining in brain cortex synapse. golgi apparatus using this antibody. Is that expected? Could you tell me where is SYN1 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2019-12-02

Answer

From literature, brain cortex does express SYN1. Generally SYN1 expresses in cell junction, synapse. golgi apparatus. Regarding which tissues have SYN1 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 2110562, 15772651
Brain cortex, Pubmed ID: 15822905

Boster Scientific Support

Answered: 2019-12-02

Question

I see that the anti-Synapsin I/SYN1 antibody PB10099 works with IHC, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-10-17

Answer

You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to support@bosterbio.com

Boster Scientific Support

Answered: 2019-10-17

Question

We purchased anti-Synapsin I/SYN1 antibody for WB on anterior cingulate cortex last year. I am using human, and We intend to use the antibody for IHC next. I am interested in examining anterior cingulate cortex as well as brain in our next experiment. Could give a recommendation on which antibody would work the best for IHC?

Verified Customer

Verified customer

Asked: 2019-09-04

Answer

I looked at the website and datasheets of our anti-Synapsin I/SYN1 antibody and it seems that PB10099 has been validated on human in both WB and IHC. Thus PB10099 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2019-09-04

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for brain using anti-Synapsin I/SYN1 antibody PB10099. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-08-27

Answer

Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-08-27

Question

We are currently using anti-Synapsin I/SYN1 antibody PB10099 for rat tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on horse tissues as well?

Verified Customer

Verified customer

Asked: 2019-08-12

Answer

The anti-Synapsin I/SYN1 antibody (PB10099) has not been tested for cross reactivity specifically with horse tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-08-12

Question

My question regarding product PB10099, anti-Synapsin I/SYN1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-05-30

Answer

It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB10099 anti-Synapsin I/SYN1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-05-30

Question

We have seen staining in human brain. Any tips? Is anti-Synapsin I/SYN1 antibody supposed to stain brain positively?

Verified Customer

Verified customer

Asked: 2018-08-28

Answer

From literature brain does express SYN1. From Uniprot.org, SYN1 is expressed in anterior cingulate cortex, brain, brain cortex, among other tissues. Regarding which tissues have SYN1 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 2110562, 15772651
Brain cortex, Pubmed ID: 15822905

Boster Scientific Support

Answered: 2018-08-28

Question

I was wanting to use your anti-Synapsin I/SYN1 antibody for IHC for mouse brain on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse brain identification?

Verified Customer

Verified customer

Asked: 2018-03-14

Answer

As indicated on the product datasheet, PB10099 anti-Synapsin I/SYN1 antibody has been validated for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse brain in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2018-03-14

Question

Is this PB10099 anti-Synapsin I/SYN1 antibody reactive to the isotypes of SYN1?

R. Banerjee

Verified customer

Asked: 2017-10-26

Answer

The immunogen of PB10099 anti-Synapsin I/SYN1 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human Synapsin I (662-705aa KSQSLTNAFNLPEPAPPRPSLSQDEVKAETIRSLRKSFASL FSD), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2017-10-26

Question

I am interested in to test anti-Synapsin I/SYN1 antibody PB10099 on mouse brain for research purposes, then I may be interested in using anti-Synapsin I/SYN1 antibody PB10099 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

C. Edwards

Verified customer

Asked: 2017-07-05

Answer

The products we sell, including anti-Synapsin I/SYN1 antibody PB10099, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2017-07-05

Question

Will anti-Synapsin I/SYN1 antibody PB10099 work for IHC with brain?

B. Baker

Verified customer

Asked: 2017-04-14

Answer

According to the expression profile of brain, SYN1 is highly expressed in brain. So, it is likely that anti-Synapsin I/SYN1 antibody PB10099 will work for IHC with brain.

Boster Scientific Support

Answered: 2017-04-14

Question

Do you have a BSA free version of anti-Synapsin I/SYN1 antibody PB10099 available?

Z. Li

Verified customer

Asked: 2016-08-30

Answer

Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-Synapsin I/SYN1 antibody PB10099 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2016-08-30

Question

I would like using your anti-Synapsin I/SYN1 antibody for neurotransmitter secretion studies. Has this antibody been tested with western blotting on mouse brain? We would like to see some validation images before ordering.

C. Parker

Verified customer

Asked: 2013-11-08

Answer

Thank you for your inquiry. This PB10099 anti-Synapsin I/SYN1 antibody is validated on mouse brain. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2013-11-08

Order DetailsPrice
PB10099

100μg

$370
PB10099-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
PB10099-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
PB10099-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
PB10099-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
PB10099-APC

100 μg APC conjugated (liquid)

$820
PB10099-FITC

100 μg FITC conjugated (liquid)

$570
PB10099-Cy3

100 μg Cy3 conjugated (liquid)

$570
PB10099-Biotin

100 μg Biotin conjugated (liquid)

$570
PB10099-HRP

100 μg HRP conjugated (liquid)

$570
PB10099-PE

100 μg PE conjugated (liquid)

$820
PB10099-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB10099
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: May 23, 2026