Anti-TFPI2 Antibody Picoband™

Boster Bio Anti-TFPI2 Antibody Picoband™ catalog # A03697-1. Tested in Flow Cytometry, IHC-P, IHC-F, ICC, WB applications. This antibody reacts with Human, Mouse.

Product Info Summary

SKU: A03697-1
Size: 100μg/vial
Reactive Species: Human, Mouse
Host: Rabbit
Application: Flow Cytometry, IHC-P, IHC-F, ICC, WB

Product Name

Anti-TFPI2 Antibody Picoband™

See all TFPI-2 products

SKU/Catalog Number







Boster Bio Anti-TFPI2 Antibody Picoband™ catalog # A03697-1. Tested in Flow Cytometry, IHC-P, IHC-F, ICC, WB applications. This antibody reacts with Human, Mouse.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-TFPI2 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A03697-1)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence at the N-terminus of human TFPI2 (70-105aa EGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQ).

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A03697-1 is reactive to TFPI2 in Human, Mouse


A03697-1 is guaranteed for Flow Cytometry, IHC-P, IHC-F, ICC, WB Boster Guarantee

*Blocking peptide can be purchased at $150. Contact us for more information.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Immunohistochemistry (Frozen Section), 0.5-1μg/ml, Human
Immunocytochemistry, 0.5-1μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For TFPI2 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Tissue factor pathway inhibitor 2



Alternative Names

Placental protein 5; PP5; PP5FLJ21164; REF-1; TFPI2; TFPI-2; TFPI-2REF1; tissue factor pathway inhibitor 2 TFPI2 PP5, REF1, TFPI-2 tissue factor pathway inhibitor 2 tissue factor pathway inhibitor 2|placental protein 5|retinal pigment epithelium cell factor 1

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on TFPI2, check out the TFPI2 Infographic

TFPI2 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for TFPI2: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A03697-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-TFPI2 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-TFPI2 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

7 Customer Q&As for Anti-TFPI2 Antibody Picoband™


See attached the WB image, lot number and protocol we used for placenta using anti-TFPI2 antibody A03697-1. Please let me know if you require anything else.

A. Huang

Verified customer

Asked: 2020-03-06


Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-03-06


Is a blocking peptide available for product anti-TFPI2 antibody (A03697-1)?

Verified Customer

Verified customer

Asked: 2019-08-27


We do provide the blocking peptide for product anti-TFPI2 antibody (A03697-1). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-08-27


Will A03697-1 anti-TFPI2 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2019-08-02


You can see on the product datasheet, A03697-1 anti-TFPI2 antibody as been tested on ICC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-08-02


I was wanting to use your anti-TFPI2 antibody for ICC for mouse placenta on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse placenta identification?

Verified Customer

Verified customer

Asked: 2019-05-20


It shows on the product datasheet, A03697-1 anti-TFPI2 antibody has been tested for Flow Cytometry, IHC-P, IHC-F, ICC, WB on human, mouse tissues. We have an innovator award program that if you test this antibody and show it works in mouse placenta in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-05-20


I see that the anti-TFPI2 antibody A03697-1 works with ICC, what is the protocol used to produce the result images on the product page?

J. Taylor

Verified customer

Asked: 2019-02-12


You can find protocols for ICC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-02-12


Do you have a BSA free version of anti-TFPI2 antibody A03697-1 available?

Verified Customer

Verified customer

Asked: 2017-12-01


Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-TFPI2 antibody A03697-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2017-12-01


Does anti-TFPI2 antibody A03697-1 work for ICC with placenta?

Verified Customer

Verified customer

Asked: 2017-06-23


According to the expression profile of placenta, TFPI2 is highly expressed in placenta. So, it is likely that anti-TFPI2 antibody A03697-1 will work for ICC with placenta.

Boster Scientific Support

Answered: 2017-06-23



Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.