Anti-TIM 1/HAVCR1 Antibody

Boster Bio Anti-TIM 1/HAVCR1 Antibody catalog # RP1093. Tested in WB applications. This antibody reacts with Human. Cited in 1 publication(s).

Product Info Summary

SKU: RP1093
Size: 100μg/vial
Reactive Species: Human
Host: Rabbit
Application: WB

Product Name

Anti-TIM 1/HAVCR1 Antibody

See all TIM-1/KIM-1/HAVCR products

SKU/Catalog Number







Boster Bio Anti-TIM 1/HAVCR1 Antibody catalog # RP1093. Tested in WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-TIM 1/HAVCR1 Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # RP1093)




Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence at the C-terminus of human TIM 1 (321-359aa QQLSVSFSSLQIKALQNAVEKEVQAEDNIYIENSLYATD).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

RP1093 is reactive to HAVCR1 in Human


RP1093 is guaranteed for WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human

Validation Images & Assay Conditions

Gene/Protein Information For HAVCR1 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Hepatitis A virus cellular receptor 1




immunoglobulin superfamily

Alternative Names

CD365; HAVCR1; HAVCR-1; HAVCRT cell immunoglobin domain and mucin domain protein 1; hepatitis A virus cellular receptor 1; Kidney injury molecule 1; KIM1; KIM-1; T-cell immunoglobulin and mucin domain-containing protein 1; TIM1; TIM-1; TIM-1TIM; TIM1TIMD-1; TIMD1T-cell membrane protein 1 HAVCR1 CD365, HAVCR, HAVCR-1, KIM-1, KIM1, TIM, TIM-1, TIM1, TIMD-1, TIMD1 hepatitis A virus cellular receptor 1 hepatitis A virus cellular receptor 1|T cell immunoglobin domain and mucin domain protein 1|T-cell immunoglobulin mucin family member 1|T-cell immunoglobulin mucin receptor 1|T-cell membrane protein 1|kidney injury molecule 1

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on HAVCR1, check out the HAVCR1 Infographic

HAVCR1 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for HAVCR1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

RP1093 has been cited in 1 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Liu Y,Feng Q,Miao J,Wu Q,Zhou S,Shen W,Feng Y,Hou FF,Liu Y,Zhou L.C-X-C motif chemokine receptor 4 aggravates renal fibrosis through activating JAK/STAT/GSK3β/β-catenin pathway.J Cell Mol Med.2020 Apr;24(7):3837-3855.doi:10.1111/jcmm.14973.Epub 2020 Mar 2.PMID:32119183;PMCID:PMC7171406.
Species: Human,Mouse
RP1093 usage in article: APP:WB, SAMPLE:HKC-8 CELL, DILUTION:NA

Have you used Anti-TIM 1/HAVCR1 Antibody?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-TIM 1/HAVCR1 Antibody

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

3 Customer Q&As for Anti-TIM 1/HAVCR1 Antibody


Our lab were satisfied with the WB result of your anti-TIM 1/HAVCR1 antibody. However we have seen positive staining in cervix carcinoma membrane using this antibody. Is that expected? Could you tell me where is HAVCR1 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2019-11-21


From literature, cervix carcinoma does express HAVCR1. Generally HAVCR1 expresses in membrane. Regarding which tissues have HAVCR1 expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 18669648
Kidney, Pubmed ID: 15489334
Liver, Pubmed ID: 9658108, 15372022

Boster Scientific Support

Answered: 2019-11-21


We are currently using anti-TIM 1/HAVCR1 antibody RP1093 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on pig tissues as well?

Verified Customer

Verified customer

Asked: 2019-10-15


The anti-TIM 1/HAVCR1 antibody (RP1093) has not been tested for cross reactivity specifically with pig tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-10-15


We have observed staining in human adult mammalian kidney. Do you have any suggestions? Is anti-TIM 1/HAVCR1 antibody supposed to stain adult mammalian kidney positively?

J. Johnson

Verified customer

Asked: 2013-06-07


From what I have seen in literature adult mammalian kidney does express HAVCR1. From what I have seen in, HAVCR1 is expressed in adult mammalian kidney, liver, kidney, cervix carcinoma, among other tissues. Regarding which tissues have HAVCR1 expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 18669648
Kidney, Pubmed ID: 15489334
Liver, Pubmed ID: 9658108, 15372022

Boster Scientific Support

Answered: 2013-06-07


Total: $315

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.