Click image to see more details
Product Info Summary
| SKU: | A00477 |
|---|---|
| Size: | 100μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | ELISA, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-TIMP3 Antibody Picoband™
SKU/Catalog Number
A00477
Size
100μg/vial
Form
Lyophilized
Description
Boster Bio Anti-TIMP3 Antibody Picoband™ catalog # A00477. Tested in ELISA, WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-TIMP3 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00477)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human TIMP3 (107-141aa RVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHL), different from the related mouse and rat sequences by two amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross Reactivity
No cross reactivity with other proteins.
Reactive Species
A00477 is reactive to TIMP3 in Human, Mouse, Rat
Applications
A00477 is guaranteed for ELISA, WB Boster Guarantee
Background of TIMP-3
Metalloproteinase inhibitor 3 is a protein that in humans is encoded by the TIMP3 gene. It is mapped to 22q12.1-q13.2. This gene belongs to the tissue inhibitor of metalloproteinases gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of theextracellular matrix (ECM). Expression of this gene is induced in response to mitogenic stimulation and this netrin domain-containing protein is localized to the ECM. Mutations in this gene have been associated with the autosomal dominant disorder Sorsby's fundus dystrophy.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists world wide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.
ELISA , 0.1-0.5μg/ml, Human, -
Western blot, 0.1-0.5μg/ml, Mouse, Rat, Human
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of TIMP3 using anti-TIMP3 antibody (A00477).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat kidney tissue lysates,
Lane 2: NIH3T3 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-TIMP3 antigen affinity purified polyclonal antibody (Catalog # A00477) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for TIMP3 at approximately 24KD. The expected band size for TIMP3 is at 24KD.
Protein Target Info & Infographic
Gene/Protein Information For TIMP3 (Source: Uniprot.Org, NCBI)
Uniprot ID
P35625
Gene ID
7078
Gene Name
TIMP3
Full Name
Metalloproteinase inhibitor 3
Weight
24.145kDa
Superfamily
protease inhibitor I35 (TIMP) family
Alternative Names
HSMRK222; K222; K222TA2; metalloproteinase inhibitor 3; MIG-5 protein; Protein MIG-5; pseudoinflammatory); SFD; TIMP metallopeptidase inhibitor 3; TIMP3; TIMP-3; tissue inhibitor of metalloproteinase 3 (Sorsby fundus dystrophy; Tissue inhibitor of metalloproteinases 3 TIMP3 HSMRK222, K222, K222TA2, SFD TIMP metallopeptidase inhibitor 3 metalloproteinase inhibitor 3|MIG-5 protein|TIMP-3|protein MIG-5|tissue inhibitor of metalloproteinases 3
*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".For more info on TIMP3, check out the TIMP3 Infographic
We have 30,000+ of these available, one for each gene! check them out.
In this infographic you will see the following information for TIMP3: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]
Specific Publications For Anti-TIMP3 Antibody Picoband™ (A00477)
A00477 has been cited in 2 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Promoter methylation and expression of TIMP3 gene in gastric cancer
Bai Yx, Yi Jl, Li Jf, Sui H. World J Gastroenterol. 2007 Jul 28;13(28):3883-5. Clinicopathologic Significance Of Bag1 And Timp3 Expression In Colon Carcinoma.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-TIMP3 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Submit A Review
Be the first to review Anti-TIMP3 Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
