Overview
Product Name |
Anti-TIMP3 Antibody Picoband™
See more TIMP-3 products |
Catalog# |
A00477 |
Pack Size |
100μg/vial |
Storage & Handling |
Store at -20°C for one year. For short term storage and frequent use, store at 4°C for up to one month. Avoid repeated freeze-thaw cycles. |
Description |
Boster Bio Anti-TIMP3 Antibody Picoband™ catalog # A00477. Tested in ELISA, WB applications. This antibody reacts with Human, Mouse, Rat. Supplied as 100μg/vial in Lyophilized form antibody. |
Cite This Product |
Anti-TIMP3 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00477)
|
Antibodies Validation |
Antibodies Validation Information
|
Similar Products From Other Companies |
Anti-TIMP3 Antibody Picoband™ may replace the following items: sc 9906|sc 27286|sc 30075|sc 373842|sc 6836|sc 373839. |
Product Specs
Host |
Rabbit |
Reactive Species |
Human, Mouse, Rat |
Applications |
ELISA, WB
*Our Boster Guarantee covers the use of this product in the above
tested applications.
*Innovating Scientists reward: if you test this antibody on a species or application not listed above and share with us your results, we will provide you a full credit to purchase Boster products. |
Related Products |
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.
*Blocking peptide can be purchased at $100. Contact us for more information.
**Boster also offers various secondary antibodies for Immunoflourescecne and IHC. Take advantage of the buy 1 primary antibody get 1 secondary antibody for free promotion all year round. |
Immunogen |
A synthetic peptide corresponding to a sequence in the middle region of human TIMP3 (107-141aa RVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHL), different from the related mouse and rat sequences by two amino acids. |
Cross Reactivity |
No cross reactivity with other proteins. |
Gene/Protein Basic Information For TIMP3 (Source: Uniprot.org, NCBI)
Uniprot Id | P35625 |
---|
NCBI Gene Id | 7078 |
---|
Species Of This Entry | Human |
---|
Gene Name | TIMP3 |
---|
Protein Name | Metalloproteinase inhibitor 3 |
---|
Superfamily | protease inhibitor I35 (TIMP) family |
---|
Alternative Names | TIMP-3|HSMRK222; K222; K222TA2; metalloproteinase inhibitor 3; MIG-5 protein; Protein MIG-5; pseudoinflammatory); SFD; TIMP metallopeptidase inhibitor 3; TIMP3; TIMP-3; tissue inhibitor of metalloproteinase 3 (Sorsby fundus dystrophy; Tissue inhibitor of metalloproteinases 3 |
---|
Molecular Weight | 24145 |
---|
*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".
For more info on TIMP3, check out the TIMP3 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
Want a nice infographic on your next protein? Boster's got them all. All proteins in the human genome, and some, can be found in the Boster Bio gene infographics. Download it and share it with your colleagues and friends. Big size posters available upon request.
In this infographic you will see the following information for TIMP3: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. Some times it even contains some opt-ed articles the Boster team on the scientific news and clinical impacts of this protein, though not all have that. Too many proteins, you know.
Take me to the TIMP3 infographic
Our Boster Quality Guarantee for Anti-TIMP3 Antibody Picoband™ covers its use in the following applications.
ELISA , 0.1-0.5μg/ml, Human, -
Western blot, 0.1-0.5μg/ml, Mouse, Rat, Human
*The recommended dilution ratios/concentrations are for reference only and optimal dilutions/concentrations should be determined by the end user.

Figure 1. Western blot analysis of TIMP3 using anti-TIMP3 antibody (A00477).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat kidney tissue lysates,
Lane 2: NIH3T3 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-TIMP3 antigen affinity purified polyclonal antibody (Catalog # A00477) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for TIMP3 at approximately 24KD. The expected band size for TIMP3 is at 24KD.
Specific Protocols
Boster provides comprehensive technical information for WB, IHC/IF/ICC, Flow Cytometry sample preparation protocols, assay protocols, troubleshooting tips and assay optimization tips.
Did You Know ?
That Boster Bio offers comprehensive selection of Western blot and IHC reagents? Great quality and save up to 50% cost.
Other Recommended Resources
Here are featured tools and databases that you might find useful.
Total number of citations: 2
Promoter methylation and expression of TIMP3 gene in gastric cancer |
PubMed ID 23819566 |
Bai Yx, Yi Jl, Li Jf, Sui H. World J Gastroenterol. 2007 Jul 28;13(28):3883-5. Clinicopathologic Significance Of Bag1 And Timp3 Expression In Colon Carcinoma. |
PubMed ID 17657847 |
|
0 reviews
Contact us with any questions at [email protected] or go to contact us
Questions and answers from customers related to A00477 Anti-TIMP3 Antibody Picoband™
0 Related Questions