Anti-TIMP3 Antibody Picoband™

TIMP-3 antibody

Boster Bio Anti-TIMP3 Antibody Picoband™ catalog # A00477. Tested in ELISA, WB applications. This antibody reacts with Human, Mouse, Rat. Cited in 2 publication(s).

Product Info Summary

SKU: A00477
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: ELISA, WB

Product Name

Anti-TIMP3 Antibody Picoband™

View all TIMP-3 Antibodies

SKU/Catalog Number

A00477

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-TIMP3 Antibody Picoband™ catalog # A00477. Tested in ELISA, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-TIMP3 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00477)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human TIMP3 (107-141aa RVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHL), different from the related mouse and rat sequences by two amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A00477 is reactive to TIMP3 in Human, Mouse, Rat

Applications

A00477 is guaranteed for ELISA, WB Boster Guarantee

Background of TIMP-3

Metalloproteinase inhibitor 3 is a protein that in humans is encoded by the TIMP3 gene. It is mapped to 22q12.1-q13.2. This gene belongs to the tissue inhibitor of metalloproteinases gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of theextracellular matrix (ECM). Expression of this gene is induced in response to mitogenic stimulation and this netrin domain-containing protein is localized to the ECM. Mutations in this gene have been associated with the autosomal dominant disorder Sorsby's fundus dystrophy.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

ELISA , 0.1-0.5μg/ml, Human, -
Western blot, 0.1-0.5μg/ml, Mouse, Rat, Human

Validation Images & Assay Conditions

Gene/Protein Information For TIMP3 (Source: Uniprot.Org, NCBI)

Uniprot ID

P35625

Gene ID

7078

Gene Name

TIMP3

Full Name

Metalloproteinase inhibitor 3

Weight

24.145kDa

Superfamily

protease inhibitor I35 (TIMP) family

Alternative Names

HSMRK222; K222; K222TA2; metalloproteinase inhibitor 3; MIG-5 protein; Protein MIG-5; pseudoinflammatory); SFD; TIMP metallopeptidase inhibitor 3; TIMP3; TIMP-3; tissue inhibitor of metalloproteinase 3 (Sorsby fundus dystrophy; Tissue inhibitor of metalloproteinases 3 TIMP3 HSMRK222, K222, K222TA2, SFD TIMP metallopeptidase inhibitor 3 metalloproteinase inhibitor 3|MIG-5 protein|TIMP-3|protein MIG-5|tissue inhibitor of metalloproteinases 3

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on TIMP3, check out the TIMP3 Infographic

TIMP3 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for TIMP3: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

A00477 has been cited in 2 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Promoter methylation and expression of TIMP3 gene in gastric cancer

Bai Yx, Yi Jl, Li Jf, Sui H. World J Gastroenterol. 2007 Jul 28;13(28):3883-5. Clinicopathologic Significance Of Bag1 And Timp3 Expression In Colon Carcinoma.

Have you used Anti-TIMP3 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-TIMP3 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Anti-TIMP3 Antibody Picoband™

Conjugation

how to order through PO

Size

Total: $315

Size:100μg

SKU:A00477

Ask a question

Get A Quote

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

Product Categories

Primary Antibodies

Primary and Secondary Antibodies

Boster Bio offers over 16,000 antibodies that have been validated for IHC, WB, ELISA, and FC in human, mouse, and rat samples. Rabbit and mouse monoclonal antibodies as well as rabbit polyclonal antibodies are available. Buy a primary antibody and get a secondary antibody for free!

ELISA Kits

ELISA Kits

More than 1,000 ELISA kits, both singleplex and multiplex, that have been cited 6,000+ times are available at Boster. We offer our Boster-branded Picokine™ ELISA kits (sandwich ELISA) and EZ-Set™ ELISA kits (DIY antibody pairs) in addition to many multiplex ELISA kits.

Image

Recombinant Proteins

Boster provides a wide range of human, mouse, and rat recombinant proteins, which include cytokines, growth factors, chemokines, and many more. Our recombinant proteins have high stability, biological activity, and purity.

Boster Kit

Reagents

Boster offers all the reagents you need for your immunostaining and western blotting experiments. We've got everything from buffers to lysates to kits, including our popular and well-cited BCA, CCK-8, and MTT assay kits.

In stock
Order Product
A00477
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$315.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.