Anti-TMEM166/EVA1A Antibody Picoband™

TMEM166 antibody

Boster Bio Anti-TMEM166/EVA1A Antibody Picoband™ catalog # A11580-1. Tested in Flow Cytometry, IHC, IHC-F, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A11580-1
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IHC, IHC-F, ICC, WB

Customers Who Bought This Also Bought

Product Name

Anti-TMEM166/EVA1A Antibody Picoband™

View all TMEM166 Antibodies

SKU/Catalog Number



100 μg/vial




Boster Bio Anti-TMEM166/EVA1A Antibody Picoband™ catalog # A11580-1. Tested in Flow Cytometry, IHC, IHC-F, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-TMEM166/EVA1A Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A11580-1)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




Rabbit IgG


A synthetic peptide corresponding to a sequence of human TMEM166/EVA1A (MRLPLSHSPEHVEMALLSNILAAYSFVSENPERA).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.


No cross-reactivity with other proteins.

Reactive Species

A11580-1 is reactive to EVA1A in Human, Mouse, Rat


A11580-1 is guaranteed for Flow Cytometry, IHC, IHC-F, ICC, WB Boster Guarantee

Background of TMEM166

Eva-1 homolog A (C. elegans) is a protein that in humans is encoded by the EVA1A gene. It belongs to the FAM176 family. This gene is mapped to 2p12. EVA1A, also called TMEM166, acts as a regulator of programmed cell death, mediating both autophagy and apoptosis.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For EVA1A (Source:, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Protein eva-1 homolog A




EVA1 family

Alternative Names

family with sequence similarity 176, member A; TMEM166; Transmembrane protein 166FLJ13391 EVA1A FAM176A, TMEM166 eva-1 homolog A, regulator of programmed cell death protein eva-1 homolog A|family with sequence similarity 176, member A|protein FAM176A|transmembrane protein 166

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on EVA1A, check out the EVA1A Infographic

EVA1A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for EVA1A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected]

No publications found for A11580-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-TMEM166/EVA1A Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-TMEM166/EVA1A Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

3 Customer Q&As for Anti-TMEM166/EVA1A Antibody Picoband™


We are currently using anti-TMEM166/EVA1A antibody A11580-1 for rat tissue, and we are happy with the ICC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on bovine tissues as well?

Verified Customer

Verified customer

Asked: 2020-03-19


The anti-TMEM166/EVA1A antibody (A11580-1) has not been validated for cross reactivity specifically with bovine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-03-19


Is there a BSA free version of anti-TMEM166/EVA1A antibody A11580-1 available?

Verified Customer

Verified customer

Asked: 2019-09-20


We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-TMEM166/EVA1A antibody A11580-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-09-20


Does anti-TMEM166/EVA1A antibody A11580-1 work on pig ICC with placenta?

J. Johnson

Verified customer

Asked: 2019-02-13


Our lab technicians have not tested anti-TMEM166/EVA1A antibody A11580-1 on pig. You can run a BLAST between pig and the immunogen sequence of anti-TMEM166/EVA1A antibody A11580-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated pig samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in pig placenta in ICC, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-02-13



Total: $315


Ask a question

Get A Quote

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.