Anti-RAGE/AGER Antibody Picoband®

AGER antibody

Boster Bio Anti-RAGE/AGER Antibody Picoband® catalog # PB9469. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 1 publication(s).

Product Info Summary

SKU: PB9469
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB
Designing a Western blot for AGER? The guide covers the expected band size, antibodies backed by real blot images, the controls to run alongside, and protocols taken from published papers.
Open the AGER Western Blot Guide

Customers Who Bought This Also Bought

Product Name

Anti-RAGE/AGER Antibody Picoband®

View all AGER Antibodies

SKU/Catalog Number

PB9469

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-RAGE/AGER Antibody Picoband® catalog # PB9469. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-RAGE/AGER Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9469)

Host

Rabbit

Contents

Each vial contains antibody formulated with stabilizing components, 0.9 mg NaCl, 0.2 mg Na2HPO4, and 0.05 mg NaN3.
*This antibody is supplied in a stabilized formulation.
Compatibility with conjugation reactions depends on the chemistry of the conjugation method used.
For conjugation methods that are not compatible with the stabilizing components present in this formulation, a carrier-free antibody format is required.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human RAGE, different from the related mouse and rat sequences by six amino acids.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9469 is reactive to AGER in Human, Mouse, Rat

Observed Molecular Weight

45-55 kDa

Calculated molecular weight

42.8 kDa

Background of AGER

The receptor for advanced glycation end products (RAGE) is a multi-ligand member of the immunoglobulin superfamily of cell surface molecules. It interacts with distinct molecules implicated in homeostasis, development and inflammation, and certain diseases such as diabetes and Alzheimer's disease. RAGE is also a central cell surface receptor for amphoterin and EN-RAGE. And RAGE is associated with sustained NF-kappaB activation in the diabetic microenvironment and has a central role in sensory neuronal dysfunction. Moreover, RAGE propagates cellular dysfunction in several inflammatory disorders and diabetes, and it also functions as an endothelial adhesion receptor promoting leukocyte recruitment.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB9469 is guaranteed for IHC, WB Boster Guarantee

Recommend Dilution

ApplicationDilutionSpecies
Immunohistochemistry (Paraffin-embedded Section)0.5-1μg/mlHuman, Mouse, Rat
Western blot0.1-0.5μg/mlHuman, Rat

Tested application

RAGE antibody was positively detected by WB in:
rat lung tissue, mouse lung tissue
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane
RAGE antibody was positively detected by IHC in:
mouse lung tissue, rat lung tissue, human intestinal cancer tissue
Use TE buffer pH 9.0 for antigen retrieval; (*) citrate buffer pH 6.0 is an alternative.

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-RAGE/AGER Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-RAGE/AGER Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

7 Customer Q&As for Anti-RAGE/AGER Antibody Picoband®

Question

I see that the anti-RAGE/AGER antibody PB9469 works with IHC, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2020-04-02

Answer

You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to support@bosterbio.com

Boster Scientific Support

Answered: 2020-04-02

Question

I am interested in to test anti-RAGE/AGER antibody PB9469 on rat aortic smooth muscle lung for research purposes, then I may be interested in using anti-RAGE/AGER antibody PB9469 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2020-01-15

Answer

The products we sell, including anti-RAGE/AGER antibody PB9469, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2020-01-15

Question

Is this PB9469 anti-RAGE/AGER antibody reactive to the isotypes of AGER?

Verified Customer

Verified customer

Asked: 2019-11-08

Answer

The immunogen of PB9469 anti-RAGE/AGER antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human RAGE (91-120aa IQDEGIFRCQAMNRNGKETKSNYRVRVYQI), different from the related mouse and rat sequences by six amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-11-08

Question

I was wanting to use your anti-RAGE/AGER antibody for IHC for rat aortic smooth muscle lung on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for rat aortic smooth muscle lung identification?

Verified Customer

Verified customer

Asked: 2019-08-29

Answer

You can see on the product datasheet, PB9469 anti-RAGE/AGER antibody has been tested for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat aortic smooth muscle lung in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-08-29

Question

Would anti-RAGE/AGER antibody PB9469 work on pig IHC with aortic smooth muscle lung?

Verified Customer

Verified customer

Asked: 2018-01-19

Answer

Our lab technicians have not tested anti-RAGE/AGER antibody PB9469 on pig. You can run a BLAST between pig and the immunogen sequence of anti-RAGE/AGER antibody PB9469 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated pig samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in pig aortic smooth muscle lung in IHC, you can get your next antibody for free.

Boster Scientific Support

Answered: 2018-01-19

Question

We are currently using anti-RAGE/AGER antibody PB9469 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on bovine tissues as well?

C. Miller

Verified customer

Asked: 2017-07-18

Answer

The anti-RAGE/AGER antibody (PB9469) has not been validated for cross reactivity specifically with bovine tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2017-07-18

Question

Is a blocking peptide available for product anti-RAGE/AGER antibody (PB9469)?

A. Bhatt

Verified customer

Asked: 2014-09-09

Answer

We do provide the blocking peptide for product anti-RAGE/AGER antibody (PB9469). If you would like to place an order for it please contact support@bosterbio.com and make a special request.

Boster Scientific Support

Answered: 2014-09-09

Order DetailsPrice
PB9469

100μg

$370
PB9469-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
PB9469-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
PB9469-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
PB9469-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
PB9469-APC

100 μg APC conjugated (liquid)

$820
PB9469-FITC

100 μg FITC conjugated (liquid)

$570
PB9469-Cy3

100 μg Cy3 conjugated (liquid)

$570
PB9469-Biotin

100 μg Biotin conjugated (liquid)

$570
PB9469-HRP

100 μg HRP conjugated (liquid)

$570
PB9469-PE

100 μg PE conjugated (liquid)

$820
PB9469-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9469
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: Sep 3, 2026