Anti-MRP1/ABCC1 Antibody Picoband™

Boster Bio Anti-MRP1/ABCC1 Antibody Picoband™ catalog # A00872. Tested in WB applications. This antibody reacts with Human. Cited in 4 publication(s).

Product Info Summary

SKU: A00872
Size: 100ug/vial
Reactive Species: Human
Host: Rabbit
Application: WB

Product Name

Anti-MRP1/ABCC1 Antibody Picoband™

See all MRP1 products

SKU/Catalog Number







Boster Bio Anti-MRP1/ABCC1 Antibody Picoband™ catalog # A00872. Tested in WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-MRP1/ABCC1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00872)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




Rabbit IgG


A synthetic peptide corresponding to a sequence at the C-terminus of human MRP1 (1493-1528aa DYTRVIVLDKGEIQEYGAPSDLLQQRGLFYSMAKDA), different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A00872 is reactive to ABCC1 in Human


A00872 is guaranteed for WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human

Validation Images & Assay Conditions

Gene/Protein Information For ABCC1 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Multidrug resistance-associated protein 1




ABC transporter superfamily

Alternative Names

ABC29; ABCC; ABCC1; ATP-binding cassette sub-family C member 1; ATP-binding cassette, sub-family C (CFTR/MRP), member 1; EC 3.6.3; EC; GS-X; Leukotriene C(4) transporter; LTC4 transporter; MRP1; MRP1DKFZp781G125; MRPDKFZp686N04233; multidrug resistance associated protein 1; multidrug resistance protein; multidrug resistance-associated protein 1; multiple drug resistance protein 1; multiple drug resistance-associated protein ABCC1 ABC29, ABCC, DFNA77, GS-X, MRP, MRP1 ATP binding cassette subfamily C member 1 multidrug resistance-associated protein 1|ATP-binding cassette transporter variant ABCC1delta-ex13|ATP-binding cassette transporter variant ABCC1delta-ex13&14|ATP-binding cassette transporter variant ABCC1delta-ex25|ATP-binding cassette transporter variant ABCC1delta-ex25&26|ATP-binding cassette, sub-family C (CFTR/MRP), member 1|LTC4 transporter|glutathione-S-conjugate-translocating ATPase ABCC1|leukotriene C(4) transporter

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on ABCC1, check out the ABCC1 Infographic

ABCC1 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for ABCC1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

A00872 has been cited in 4 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Characteristics of doxorubicin-selected multidrug-resistant human leukemia HL-60 cells with tolerance to arsenic trioxide and contribution of leukemia stem cells

Acetazolamide Suppresses Multi-Drug Resistance-Related Protein 1 and P-Glycoprotein Expression by Inhibiting Aquaporins Expression in a Mesial Temporal Epilepsy Rat Model

Enhanced autophagy reveals vulnerability of P-gp mediated epirubicin resistance in triple negative breast cancer cells

Enhanced combination therapy effect on paclitaxel-resistant carcinoma by chloroquine co-delivery via liposomes

Have you used Anti-MRP1/ABCC1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-MRP1/ABCC1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Anti-MRP1/ABCC1 Antibody Picoband™


Total: $315

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.