Anti-OGT/O-Linked N-Acetylglucosamine Transferase Antibody Picoband™

O-GlcNAc Transferase p110 subunit antibody

Boster Bio Anti-OGT/O-Linked N-Acetylglucosamine Transferase Antibody Picoband™ catalog # PB9767. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: PB9767
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IF, IHC, ICC, WB

Customers Who Bought This Also Bought

Product Name

Anti-OGT/O-Linked N-Acetylglucosamine Transferase Antibody Picoband™

View all O-GlcNAc Transferase p110 subunit Antibodies

SKU/Catalog Number

PB9767

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-OGT/O-Linked N-Acetylglucosamine Transferase Antibody Picoband™ catalog # PB9767. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-OGT/O-Linked N-Acetylglucosamine Transferase Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9767)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human OGT, identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

PB9767 is reactive to OGT in Human, Mouse, Rat

Applications

PB9767 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee

Observed Molecular Weight

117 kDa

Calculated molecular weight

116.925kDa

Background of O-GlcNAc Transferase p110 subunit

O-linked N-acetylglucosamine (O-GlcNAc) transferase (OGT) is an enzyme that in humans is encoded by the OGT gene. This gene encodes a glycosyltransferase that catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains multiple tetratricopeptide repeats that are required for optimal recognition of substrates. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human, Mouse

Validation Images & Assay Conditions

Gene/Protein Information For OGT (Source: Uniprot.org, NCBI)

Gene Name

OGT

Full Name

UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit

Weight

116.925kDa

Superfamily

glycosyltransferase 41 family

Alternative Names

EC 2.4.1; EC 2.4.1.255 ; FLJ23071; HRNT1; MGC22921; O-GlcNAc transferase p110 subunit; O-GlcNAc transferase subunit p110; OGlcNAc Transferase; O-GlcNAc Transferase; O-GLCNAC; OGT; O-linked N-acetylglucosamine (GlcNAc) transferase(UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase); O-linked N-acetylglucosamine transferase 110 kDa subunit; UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDasubunit; uridinediphospho-N-acetylglucosamine:polypeptide beta-N-acetylglucosaminyltransferase OGT HINCUT-1, HRNT1, MRX106, O-GLCNAC1, OGT O-linked N-acetylglucosamine (GlcNAc) transferase UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit|O-GlcNAc transferase p110 subunit|O-GlcNAc transferase subunit p110|O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase)|O-linked N-acetylglucosamine transferase 110 kDa subunit|UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase|uridinediphospho-N-acetylglucosamine:polypeptide beta-N-acetylglucosaminyl transferase

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on OGT, check out the OGT Infographic

OGT infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for OGT: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for PB9767

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-OGT/O-Linked N-Acetylglucosamine Transferase Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-OGT/O-Linked N-Acetylglucosamine Transferase Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

16 Customer Q&As for Anti-OGT/O-Linked N-Acetylglucosamine Transferase Antibody Picoband™

Question

Will PB9767 anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2020-04-22

Answer

As indicated on the product datasheet, PB9767 anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2020-04-22

Question

Is this PB9767 anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody reactive to the isotypes of OGT?

Verified Customer

Verified customer

Asked: 2020-03-06

Answer

The immunogen of PB9767 anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human OGT (1008-1046aa NTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-03-06

Question

We ordered your anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody for IHC on liver in a previous project. I am using mouse, and We want to use the antibody for WB next. My question regards examining liver as well as cervix carcinoma in our next experiment. Could you please give me some suggestion on which antibody would work the best for WB?

Verified Customer

Verified customer

Asked: 2020-03-02

Answer

I viewed the website and datasheets of our anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody and it seems that PB9767 has been validated on mouse in both IHC and WB. Thus PB9767 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in mouse even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2020-03-02

Question

Is a blocking peptide available for product anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody (PB9767)?

B. Miller

Verified customer

Asked: 2020-01-16

Answer

We do provide the blocking peptide for product anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody (PB9767). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2020-01-16

Question

My question regarding product PB9767, anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-12-12

Answer

It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9767 anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-12-12

Question

My colleagues were well pleased with the WB result of your anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody. However we have observed positive staining in fetal brain spinal cord isoform 4: cytoplasm. nucleus. using this antibody. Is that expected? Could you tell me where is OGT supposed to be expressed?

Verified Customer

Verified customer

Asked: 2019-11-15

Answer

From literature, fetal brain spinal cord does express OGT. Generally OGT expresses in nucleus., isoform 2: mitochondrion, isoform 3: cytoplasm, isoform 4: cytoplasm. nucleus. Regarding which tissues have OGT expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 18669648
Colon, and Pancreas, Pubmed ID: 15489334
Endometrium, Fetal brain, and Spinal cord, Pubmed ID: 17974005
Erythroleukemia, Pubmed ID: 23186163
Hepatoma, Pubmed ID: 12150998
Liver, Pubmed ID: 9083068

Boster Scientific Support

Answered: 2019-11-15

Question

I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for fetal brain spinal cord using anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody PB9767. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-10-28

Answer

Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-10-28

Question

Please see the WB image, lot number and protocol we used for fetal brain spinal cord using anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody PB9767. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-06-11

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-06-11

Question

I was wanting to use your anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody for WB for rat fetal brain spinal cord on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for rat fetal brain spinal cord identification?

Verified Customer

Verified customer

Asked: 2019-05-29

Answer

You can see on the product datasheet, PB9767 anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody has been validated for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat fetal brain spinal cord in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-05-29

Question

I am looking for using your anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody for phosphatidylinositol-mediated signaling studies. Has this antibody been tested with western blotting on brain tissue? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2019-05-13

Answer

I appreciate your inquiry. This PB9767 anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody is tested on rat intestine tissue, brain tissue, tissue lysate, mouse intestine tissue, cardiac muscle tissue, a549 whole cell lysate. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2019-05-13

Question

We have observed staining in rat liver. Do you have any suggestions? Is anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody supposed to stain liver positively?

Verified Customer

Verified customer

Asked: 2018-10-30

Answer

According to literature liver does express OGT. According to Uniprot.org, OGT is expressed in middle temporal gyrus, liver, endometrium, fetal brain spinal cord, colon pancreas, hepatoma, cervix carcinoma, erythroleukemia, among other tissues. Regarding which tissues have OGT expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 18669648
Colon, and Pancreas, Pubmed ID: 15489334
Endometrium, Fetal brain, and Spinal cord, Pubmed ID: 17974005
Erythroleukemia, Pubmed ID: 23186163
Hepatoma, Pubmed ID: 12150998
Liver, Pubmed ID: 9083068

Boster Scientific Support

Answered: 2018-10-30

Question

Is there a BSA free version of anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody PB9767 available?

Verified Customer

Verified customer

Asked: 2018-09-20

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody PB9767 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2018-09-20

Question

We are currently using anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody PB9767 for human tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on horse tissues as well?

R. Anderson

Verified customer

Asked: 2018-03-08

Answer

The anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody (PB9767) has not been validated for cross reactivity specifically with horse tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2018-03-08

Question

I see that the anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody PB9767 works with WB, what is the protocol used to produce the result images on the product page?

J. Li

Verified customer

Asked: 2017-05-18

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2017-05-18

Question

Does anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody PB9767 work for WB with fetal brain spinal cord?

K. Edwards

Verified customer

Asked: 2015-08-10

Answer

According to the expression profile of fetal brain spinal cord, OGT is highly expressed in fetal brain spinal cord. So, it is likely that anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody PB9767 will work for WB with fetal brain spinal cord.

Boster Scientific Support

Answered: 2015-08-10

Question

I am interested in to test anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody PB9767 on rat fetal brain spinal cord for research purposes, then I may be interested in using anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody PB9767 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

F. Moore

Verified customer

Asked: 2013-03-06

Answer

The products we sell, including anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody PB9767, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2013-03-06

Order DetailsPrice
PB9767

100μg

$370
PB9767-10ug

10μg sample (liquid)

$99
PB9767-Biotin

100 μg Biotin conjugated

$570
PB9767-Cy3

100 μg Cy3 conjugated

$570
PB9767-Dylight488

100 μg Dylight488 conjugated

$570
PB9767-Dylight550

100 μg Dylight550 conjugated

$570
PB9767-Dylight594

100 μg Dylight594 conjugated

$570
PB9767-FITC

100 μg FITC conjugated

$570
PB9767-HRP

100 μg HRP conjugated

$570
PB9767-APC

100 μg APC conjugated

$670
PB9767-PE

100 μg PE conjugated

$670
PB9767-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
Eddy test
In stock
Order Product
PB9767
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.