Product Info Summary
SKU: | PB9767 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | Flow Cytometry, IF, IHC, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-OGT/O-Linked N-Acetylglucosamine Transferase Antibody Picoband™
View all O-GlcNAc Transferase p110 subunit Antibodies
SKU/Catalog Number
PB9767
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-OGT/O-Linked N-Acetylglucosamine Transferase Antibody Picoband™ catalog # PB9767. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-OGT/O-Linked N-Acetylglucosamine Transferase Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9767)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human OGT, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
PB9767 is reactive to OGT in Human, Mouse, Rat
Applications
PB9767 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee
Observed Molecular Weight
117 kDa
Calculated molecular weight
116.925kDa
Background of O-GlcNAc Transferase p110 subunit
O-linked N-acetylglucosamine (O-GlcNAc) transferase (OGT) is an enzyme that in humans is encoded by the OGT gene. This gene encodes a glycosyltransferase that catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains multiple tetratricopeptide repeats that are required for optimal recognition of substrates. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human, Mouse
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of OGT using anti-OGT antibody (PB9767).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysates,
Lane 2: human PC-3 whole cell lysates,
Lane 3: human A431 whole cell lysates,
Lane 4: human A549 whole cell lysates,
Lane 5: human Caco-2 whole cell lysates,
Lane 6: human K562 whole cell lysates,
Lane 7: rat heart tissue lysates,
Lane 8: mouse heart tissue lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-OGT antigen affinity purified polyclonal antibody (Catalog # PB9767) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for OGT at approximately 117KD. The expected band size for OGT is at 117KD.
Click image to see more details
Figure 2. IHC analysis of OGT using anti-OGT antibody (PB9767).
OGT was detected in a paraffin-embedded section of mouse intestine tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-OGT Antibody (PB9767) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of OGT using anti-OGT antibody (PB9767).
OGT was detected in a paraffin-embedded section of rat intestine tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1 μg/ml rabbit anti-OGT Antibody (PB9767) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 4. IHC analysis of OGT using anti-OGT antibody (PB9767).
OGT was detected in paraffin-embedded section of human gastric cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-OGT Antibody (PB9767) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 5. IHC analysis of OGT using anti-OGT antibody (PB9767).
OGT was detected in paraffin-embedded section of human pancreatic cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-OGT Antibody (PB9767) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 6. IHC analysis of OGT using anti-OGT antibody (PB9767).
OGT was detected in paraffin-embedded section of rat pancreas tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-OGT Antibody (PB9767) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 7. IF analysis of OGT using anti-OGT antibody (PB9767).
OGT was detected in immunocytochemical section of A431 cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 2μg/mL rabbit anti-OGT Antibody (PB9767) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG (BA1127) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Click image to see more details
Figure 8. Flow Cytometry analysis of U937 cells using anti-OGT antibody (PB9767).
Overlay histogram showing U937 cells stained with PB9767 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-OGT Antibody (PB9767,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Click image to see more details
Figure 9. Flow Cytometry analysis of RAW264.7 cells using anti-OGT antibody (PB9767).
Overlay histogram showing RAW264.7 cells stained with PB9767 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-OGT Antibody (PB9767,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Protein Target Info & Infographic
Gene/Protein Information For OGT (Source: Uniprot.org, NCBI)
Gene Name
OGT
Full Name
UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
Weight
116.925kDa
Superfamily
glycosyltransferase 41 family
Alternative Names
EC 2.4.1; EC 2.4.1.255 ; FLJ23071; HRNT1; MGC22921; O-GlcNAc transferase p110 subunit; O-GlcNAc transferase subunit p110; OGlcNAc Transferase; O-GlcNAc Transferase; O-GLCNAC; OGT; O-linked N-acetylglucosamine (GlcNAc) transferase(UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase); O-linked N-acetylglucosamine transferase 110 kDa subunit; UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDasubunit; uridinediphospho-N-acetylglucosamine:polypeptide beta-N-acetylglucosaminyltransferase OGT HINCUT-1, HRNT1, MRX106, O-GLCNAC1, OGT O-linked N-acetylglucosamine (GlcNAc) transferase UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit|O-GlcNAc transferase p110 subunit|O-GlcNAc transferase subunit p110|O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase)|O-linked N-acetylglucosamine transferase 110 kDa subunit|UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase|uridinediphospho-N-acetylglucosamine:polypeptide beta-N-acetylglucosaminyl transferase
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on OGT, check out the OGT Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for OGT: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-OGT/O-Linked N-Acetylglucosamine Transferase Antibody Picoband™ (PB9767)
Hello CJ!
No publications found for PB9767
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-OGT/O-Linked N-Acetylglucosamine Transferase Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Submit A Review
Be the first to review Anti-OGT/O-Linked N-Acetylglucosamine Transferase Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
16 Customer Q&As for Anti-OGT/O-Linked N-Acetylglucosamine Transferase Antibody Picoband™
Question
Will PB9767 anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2020-04-22
Answer
As indicated on the product datasheet, PB9767 anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2020-04-22
Question
Is this PB9767 anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody reactive to the isotypes of OGT?
Verified Customer
Verified customer
Asked: 2020-03-06
Answer
The immunogen of PB9767 anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human OGT (1008-1046aa NTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-03-06
Question
We ordered your anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody for IHC on liver in a previous project. I am using mouse, and We want to use the antibody for WB next. My question regards examining liver as well as cervix carcinoma in our next experiment. Could you please give me some suggestion on which antibody would work the best for WB?
Verified Customer
Verified customer
Asked: 2020-03-02
Answer
I viewed the website and datasheets of our anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody and it seems that PB9767 has been validated on mouse in both IHC and WB. Thus PB9767 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in mouse even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2020-03-02
Question
Is a blocking peptide available for product anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody (PB9767)?
B. Miller
Verified customer
Asked: 2020-01-16
Answer
We do provide the blocking peptide for product anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody (PB9767). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2020-01-16
Question
My question regarding product PB9767, anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-12-12
Answer
It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9767 anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-12-12
Question
My colleagues were well pleased with the WB result of your anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody. However we have observed positive staining in fetal brain spinal cord isoform 4: cytoplasm. nucleus. using this antibody. Is that expected? Could you tell me where is OGT supposed to be expressed?
Verified Customer
Verified customer
Asked: 2019-11-15
Answer
From literature, fetal brain spinal cord does express OGT. Generally OGT expresses in nucleus., isoform 2: mitochondrion, isoform 3: cytoplasm, isoform 4: cytoplasm. nucleus. Regarding which tissues have OGT expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 18669648
Colon, and Pancreas, Pubmed ID: 15489334
Endometrium, Fetal brain, and Spinal cord, Pubmed ID: 17974005
Erythroleukemia, Pubmed ID: 23186163
Hepatoma, Pubmed ID: 12150998
Liver, Pubmed ID: 9083068
Boster Scientific Support
Answered: 2019-11-15
Question
I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for fetal brain spinal cord using anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody PB9767. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-10-28
Answer
Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-10-28
Question
Please see the WB image, lot number and protocol we used for fetal brain spinal cord using anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody PB9767. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-06-11
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-06-11
Question
I was wanting to use your anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody for WB for rat fetal brain spinal cord on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for rat fetal brain spinal cord identification?
Verified Customer
Verified customer
Asked: 2019-05-29
Answer
You can see on the product datasheet, PB9767 anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody has been validated for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat fetal brain spinal cord in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-05-29
Question
I am looking for using your anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody for phosphatidylinositol-mediated signaling studies. Has this antibody been tested with western blotting on brain tissue? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2019-05-13
Answer
I appreciate your inquiry. This PB9767 anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody is tested on rat intestine tissue, brain tissue, tissue lysate, mouse intestine tissue, cardiac muscle tissue, a549 whole cell lysate. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2019-05-13
Question
We have observed staining in rat liver. Do you have any suggestions? Is anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody supposed to stain liver positively?
Verified Customer
Verified customer
Asked: 2018-10-30
Answer
According to literature liver does express OGT. According to Uniprot.org, OGT is expressed in middle temporal gyrus, liver, endometrium, fetal brain spinal cord, colon pancreas, hepatoma, cervix carcinoma, erythroleukemia, among other tissues. Regarding which tissues have OGT expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 18669648
Colon, and Pancreas, Pubmed ID: 15489334
Endometrium, Fetal brain, and Spinal cord, Pubmed ID: 17974005
Erythroleukemia, Pubmed ID: 23186163
Hepatoma, Pubmed ID: 12150998
Liver, Pubmed ID: 9083068
Boster Scientific Support
Answered: 2018-10-30
Question
Is there a BSA free version of anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody PB9767 available?
Verified Customer
Verified customer
Asked: 2018-09-20
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody PB9767 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2018-09-20
Question
We are currently using anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody PB9767 for human tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on horse tissues as well?
R. Anderson
Verified customer
Asked: 2018-03-08
Answer
The anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody (PB9767) has not been validated for cross reactivity specifically with horse tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2018-03-08
Question
I see that the anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody PB9767 works with WB, what is the protocol used to produce the result images on the product page?
J. Li
Verified customer
Asked: 2017-05-18
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2017-05-18
Question
Does anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody PB9767 work for WB with fetal brain spinal cord?
K. Edwards
Verified customer
Asked: 2015-08-10
Answer
According to the expression profile of fetal brain spinal cord, OGT is highly expressed in fetal brain spinal cord. So, it is likely that anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody PB9767 will work for WB with fetal brain spinal cord.
Boster Scientific Support
Answered: 2015-08-10
Question
I am interested in to test anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody PB9767 on rat fetal brain spinal cord for research purposes, then I may be interested in using anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody PB9767 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
F. Moore
Verified customer
Asked: 2013-03-06
Answer
The products we sell, including anti-OGT/O-Linked N-Acetylglucosamine Transferase antibody PB9767, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2013-03-06