Anti-Angiotensin Converting Enzyme 1/Ace Antibody Picoband™

ACE/CD143 antibody

Boster Bio Anti-Angiotensin Converting Enzyme 1/Ace Antibody Picoband™ catalog # A00251. Tested in WB applications. This antibody reacts with Mouse, Rat. Cited in 2 publication(s).

Product Info Summary

SKU: A00251
Size: 100μg/vial
Reactive Species: Mouse, Rat
Host: Rabbit
Application: WB

Product Name

Anti-Angiotensin Converting Enzyme 1/Ace Antibody Picoband™

View all ACE/CD143 Antibodies

SKU/Catalog Number

A00251

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Angiotensin Converting Enzyme 1/Ace Antibody Picoband™ catalog # A00251. Tested in WB applications. This antibody reacts with Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Angiotensin Converting Enzyme 1/Ace Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00251)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence of mouse Ace (AMMNYFKPLTEWLVTENRRHGETLGWPEYNWAPNTAR).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A00251 is reactive to Ace in Mouse, Rat

Applications

A00251 is guaranteed for WB Boster Guarantee

Background of ACE/CD143

Angiotensin I converting enzyme (ACE), also called DCP or CD143 is a zinc-containing dipeptidyl carboxypeptidase widely distributed in mammalian tissues and is thought to play a critical role in blood pressure regulation. This gene is mapped to 17q23.3. This gene encodes an enzyme involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. Angiotensin II is a potent vasopressor and aldosterone-stimulating peptide that controls blood pressure and fluid-electrolyte balance. This enzyme plays a key role in the renin-angiotensin system. Many studies have associated the presence or absence of a 287 bp Alu repeat element in this gene with the levels of circulating enzyme or cardiovascular pathophysiologies.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml

Validation Images & Assay Conditions

Gene/Protein Information For Ace (Source: Uniprot.Org, NCBI)

Uniprot ID

P09470

Gene ID

11421

Gene Name

Ace

Full Name

Angiotensin-converting enzyme

Weight

150.918kDa

Superfamily

peptidase M2 family

Alternative Names

ACE; ACE1angiotensin converting enzyme, somatic isoform; angiotensin I converting enzyme (peptidyl-dipeptidase A) 1; carboxycathepsin; CD143 antigen; CD143; DCP; DCP1; DCP1angiotensin-converting enzyme; dipeptidyl carboxypeptidase 1; Dipeptidyl carboxypeptidase I; EC 3.2.1.-; EC 3.4.15.1; Kininase II; MGC26566; MVCD3; peptidase P; testicular ECA Ace|AW208573, CD143|angiotensin I converting enzyme (peptidyl-dipeptidase A) 1|angiotensin-converting enzyme|dipeptidyl carboxypeptidase I|dipeptidyl peptidase|kininase II

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on Ace, check out the Ace Infographic

Ace infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for Ace: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

A00251 has been cited in 2 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Telmisartan protects chronic intermittent hypoxic mice via modulating cardiac renin-angiotensin system activity

Aliskiren has chondroprotective efficacy in a rat model of osteoarthritis through suppression of the local renin-angiotensin system

Have you used Anti-Angiotensin Converting Enzyme 1/Ace Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Angiotensin Converting Enzyme 1/Ace Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

15 Customer Q&As for Anti-Angiotensin Converting Enzyme 1/Ace Antibody Picoband™

Question

I was wanting to use your anti-Angiotensin Converting Enzyme 1/Ace antibody for WB for rat brain on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat brain identification?

Verified Customer

Verified customer

Asked: 2020-04-23

Answer

As indicated on the product datasheet, A00251 anti-Angiotensin Converting Enzyme 1/Ace antibody has been validated for WB on mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat brain in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-04-23

Question

Will A00251 anti-Angiotensin Converting Enzyme 1/Ace antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2020-04-06

Answer

It shows on the product datasheet, A00251 anti-Angiotensin Converting Enzyme 1/Ace antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2020-04-06

Question

you antibody to test anti-Angiotensin Converting Enzyme 1/Ace antibody A00251 on rat brain for research purposes, then I may be interested in using anti-Angiotensin Converting Enzyme 1/Ace antibody A00251 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-12-06

Answer

The products we sell, including anti-Angiotensin Converting Enzyme 1/Ace antibody A00251, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-12-06

Question

Would anti-Angiotensin Converting Enzyme 1/Ace antibody A00251 work for WB with brain?

Verified Customer

Verified customer

Asked: 2019-11-22

Answer

According to the expression profile of brain, ACE is highly expressed in brain. So, it is likely that anti-Angiotensin Converting Enzyme 1/Ace antibody A00251 will work for WB with brain.

Boster Scientific Support

Answered: 2019-11-22

Question

Is this A00251 anti-Angiotensin Converting Enzyme 1/Ace antibody reactive to the isotypes of ACE?

Verified Customer

Verified customer

Asked: 2019-11-06

Answer

The immunogen of A00251 anti-Angiotensin Converting Enzyme 1/Ace antibody is A synthetic peptide corresponding to a sequence of mouse Ace (AMMNYFKPLTEWLVTENRRHGETLGWPEYNWAPNTAR). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-11-06

Question

My team were well pleased with the WB result of your anti-Angiotensin Converting Enzyme 1/Ace antibody. However we have observed positive staining in testis angiotensin-converting enzyme using this antibody. Is that expected? Could you tell me where is ACE supposed to be expressed?

Verified Customer

Verified customer

Asked: 2019-10-23

Answer

From literature, testis does express ACE. Generally ACE expresses in angiotensin-converting enzyme, soluble form:, cell membrane. Regarding which tissues have ACE expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 16625196
Liver, Pubmed ID: 19159218
Lung, Pubmed ID: 2558109
Plasma, Pubmed ID: 16335952
Testis, Pubmed ID: 14702039
Umbilical vein endothelial cell, Pubmed ID: 9642152

Boster Scientific Support

Answered: 2019-10-23

Question

I have attached the WB image, lot number and protocol we used for brain using anti-Angiotensin Converting Enzyme 1/Ace antibody A00251. Please let me know if you require anything else.

J. Jha

Verified customer

Asked: 2019-07-01

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-07-01

Question

Is a blocking peptide available for product anti-Angiotensin Converting Enzyme 1/Ace antibody (A00251)?

Verified Customer

Verified customer

Asked: 2019-06-14

Answer

We do provide the blocking peptide for product anti-Angiotensin Converting Enzyme 1/Ace antibody (A00251). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-06-14

Question

I was wanting to use using your anti-Angiotensin Converting Enzyme 1/Ace antibody for positive regulation of protein tyrosine kinase activity studies. Has this antibody been tested with western blotting on testis tissue? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2019-06-12

Answer

Thank you for your inquiry. This A00251 anti-Angiotensin Converting Enzyme 1/Ace antibody is tested on mouse lung tissue, testis tissue, stomach tissue, rat lung tissue. It is guaranteed to work for WB in mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2019-06-12

Question

We are currently using anti-Angiotensin Converting Enzyme 1/Ace antibody A00251 for mouse tissue, and we are content with the WB results. The species of reactivity given in the datasheet says mouse, rat. Is it true that the antibody can work on feline tissues as well?

Verified Customer

Verified customer

Asked: 2018-12-14

Answer

The anti-Angiotensin Converting Enzyme 1/Ace antibody (A00251) has not been tested for cross reactivity specifically with feline tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2018-12-14

Question

We have been able to see staining in mouse brain. What should we do? Is anti-Angiotensin Converting Enzyme 1/Ace antibody supposed to stain brain positively?

Verified Customer

Verified customer

Asked: 2018-10-15

Answer

According to literature brain does express ACE. According to Uniprot.org, ACE is expressed in testis, brain, lung, umbilical vein endothelial cell, plasma, liver, among other tissues. Regarding which tissues have ACE expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 16625196
Liver, Pubmed ID: 19159218
Lung, Pubmed ID: 2558109
Plasma, Pubmed ID: 16335952
Testis, Pubmed ID: 14702039
Umbilical vein endothelial cell, Pubmed ID: 9642152

Boster Scientific Support

Answered: 2018-10-15

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for brain using anti-Angiotensin Converting Enzyme 1/Ace antibody A00251. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2018-02-19

Answer

Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-02-19

Question

I see that the anti-Angiotensin Converting Enzyme 1/Ace antibody A00251 works with WB, what is the protocol used to produce the result images on the product page?

J. Lewis

Verified customer

Asked: 2017-07-14

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2017-07-14

Question

I have a question about product A00251, anti-Angiotensin Converting Enzyme 1/Ace antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

H. Zhang

Verified customer

Asked: 2016-09-02

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00251 anti-Angiotensin Converting Enzyme 1/Ace antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2016-09-02

Question

Do you have a BSA free version of anti-Angiotensin Converting Enzyme 1/Ace antibody A00251 available?

E. Johnson

Verified customer

Asked: 2014-02-04

Answer

Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-Angiotensin Converting Enzyme 1/Ace antibody A00251 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2014-02-04

Conjugation

how to order through PO

Size

Total: $315

Size:100μg

SKU:A00251

Ask a question

Get A Quote

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

Product Categories

Primary Antibodies

Primary and Secondary Antibodies

Boster Bio offers over 16,000 antibodies that have been validated for IHC, WB, ELISA, and FC in human, mouse, and rat samples. Rabbit and mouse monoclonal antibodies as well as rabbit polyclonal antibodies are available. Buy a primary antibody and get a secondary antibody for free!

ELISA Kits

ELISA Kits

More than 1,000 ELISA kits, both singleplex and multiplex, that have been cited 6,000+ times are available at Boster. We offer our Boster-branded Picokine™ ELISA kits (sandwich ELISA) and EZ-Set™ ELISA kits (DIY antibody pairs) in addition to many multiplex ELISA kits.

Image

Recombinant Proteins

Boster provides a wide range of human, mouse, and rat recombinant proteins, which include cytokines, growth factors, chemokines, and many more. Our recombinant proteins have high stability, biological activity, and purity.

Boster Kit

Reagents

Boster offers all the reagents you need for your immunostaining and western blotting experiments. We've got everything from buffers to lysates to kits, including our popular and well-cited BCA, CCK-8, and MTT assay kits.

In stock
Order Product
A00251
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$315.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.