Anti-Ago2/eIF2C2 Antibody Picoband®

AGO2 antibody

Boster Bio Anti-Ago2/eIF2C2 Antibody Picoband® catalog # PB9978. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 4 publication(s).

Product Info Summary

SKU: PB9978
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Customers Who Bought This Also Bought

Product Name

Anti-Ago2/eIF2C2 Antibody Picoband®

View all AGO2 Antibodies

SKU/Catalog Number

PB9978
PB1030 is an alternative SKU for this antibody, used in previous lots.

Size

100 μg/vial

Form

Lyophilized

Description

AGO2 (EIF2C2) is a core component of the RNA-induced silencing complex (RISC) required for RNAi/miRNA-mediated gene silencing, binding short guide RNAs to direct target repression. Assay context: Human/Mouse/Rat-reactive Picoband antibody validated for WB. Frequently evaluated alongside other Argonautes such as AGO3 to distinguish shared vs isoform-skewed small-RNA programs (putative co-panel; assay and cell-state dependent).

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Ago2/eIF2C2 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9978)

Host

Rabbit

Contents

Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human Ago2/ eIF2C2, identical to the related mouse and rat sequences.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

PB9978 is reactive to AGO2 in Human, Mouse, Rat

Observed Molecular Weight

97 kDa

Calculated molecular weight

97.2 kDa

Background of AGO2

Protein argonaute-2, also known as AGO2, is a protein that in humans is encoded by the EIF2C2 gene. This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB9978 is guaranteed for WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat

Positive Control

WB: human Jurkat whole cell, human 293T whole cell, human K562 whole cell, human MCF-7 whole cell, rat lung tissue, rat pancreas tissue, mouse pancreas tissue

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-Ago2/eIF2C2 Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-Ago2/eIF2C2 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

15 Customer Q&As for Anti-Ago2/eIF2C2 Antibody Picoband®

Question

I have a question about product PB9978, anti-Ago2/eIF2C2 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2020-03-12

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9978 anti-Ago2/eIF2C2 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2020-03-12

Question

Does anti-Ago2/eIF2C2 antibody PB9978 work for WB with brain eye?

Verified Customer

Verified customer

Asked: 2020-02-27

Answer

According to the expression profile of brain eye, AGO2 is highly expressed in brain eye. So, it is likely that anti-Ago2/eIF2C2 antibody PB9978 will work for WB with brain eye.

Boster Scientific Support

Answered: 2020-02-27

Question

We have observed staining in rat cervix carcinoma erythroleukemia. What should we do? Is anti-Ago2/eIF2C2 antibody supposed to stain cervix carcinoma erythroleukemia positively?

Verified Customer

Verified customer

Asked: 2020-02-27

Answer

Based on literature cervix carcinoma erythroleukemia does express AGO2. Based on Uniprot.org, AGO2 is expressed in forebrain, brain eye, cervix carcinoma erythroleukemia, among other tissues. Regarding which tissues have AGO2 expression, here are a few articles citing expression in various tissues:
Brain, and Eye, Pubmed ID: 15489334
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163

Boster Scientific Support

Answered: 2020-02-27

Question

I was wanting to use to test anti-Ago2/eIF2C2 antibody PB9978 on mouse brain eye for research purposes, then I may be interested in using anti-Ago2/eIF2C2 antibody PB9978 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-02-21

Answer

The products we sell, including anti-Ago2/eIF2C2 antibody PB9978, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-02-21

Question

I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for brain eye using anti-Ago2/eIF2C2 antibody PB9978. Let me know if you need anything else.

G. Edwards

Verified customer

Asked: 2019-02-08

Answer

I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-02-08

Question

I am looking for using your anti-Ago2/eIF2C2 antibody for positive regulation of angiogenesis studies. Has this antibody been tested with western blotting on mouse brain? We would like to see some validation images before ordering.

M. Miller

Verified customer

Asked: 2019-01-28

Answer

Thanks for your inquiry. This PB9978 anti-Ago2/eIF2C2 antibody is validated on mouse brain, hela whole cell lysates. It is guaranteed to work for WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2019-01-28

Question

Is there a BSA free version of anti-Ago2/eIF2C2 antibody PB9978 available?

J. Thomas

Verified customer

Asked: 2018-11-21

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Ago2/eIF2C2 antibody PB9978 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2018-11-21

Question

Is a blocking peptide available for product anti-Ago2/eIF2C2 antibody (PB9978)?

Verified Customer

Verified customer

Asked: 2018-04-11

Answer

We do provide the blocking peptide for product anti-Ago2/eIF2C2 antibody (PB9978). If you would like to place an order for it please contact support@bosterbio.com and make a special request.

Boster Scientific Support

Answered: 2018-04-11

Question

I was wanting to use your anti-Ago2/eIF2C2 antibody for WB for mouse brain eye on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse brain eye identification?

B. Wu

Verified customer

Asked: 2017-12-08

Answer

It shows on the product datasheet, PB9978 anti-Ago2/eIF2C2 antibody has been tested for WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse brain eye in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2017-12-08

Question

I see that the anti-Ago2/eIF2C2 antibody PB9978 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2017-06-13

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to support@bosterbio.com

Boster Scientific Support

Answered: 2017-06-13

Question

Would PB9978 anti-Ago2/eIF2C2 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

D. Singh

Verified customer

Asked: 2016-06-15

Answer

It shows on the product datasheet, PB9978 anti-Ago2/eIF2C2 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2016-06-15

Question

We are currently using anti-Ago2/eIF2C2 antibody PB9978 for rat tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on dog tissues as well?

T. Jones

Verified customer

Asked: 2015-09-04

Answer

The anti-Ago2/eIF2C2 antibody (PB9978) has not been tested for cross reactivity specifically with dog tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2015-09-04

Question

Is this PB9978 anti-Ago2/eIF2C2 antibody reactive to the isotypes of AGO2?

F. Jackson

Verified customer

Asked: 2014-12-22

Answer

The immunogen of PB9978 anti-Ago2/eIF2C2 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human Ago2/ eIF2C2 (129-169aa KVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHL), identical to the related mouse and rat sequences. . Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2014-12-22

Question

See attached the WB image, lot number and protocol we used for brain eye using anti-Ago2/eIF2C2 antibody PB9978. Please let me know if you require anything else.

L. Patel

Verified customer

Asked: 2014-07-30

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2014-07-30

Question

My colleagues were well pleased with the WB result of your anti-Ago2/eIF2C2 antibody. However we have seen positive staining in cervix carcinoma erythroleukemia cytoplasm using this antibody. Is that expected? Could you tell me where is AGO2 supposed to be expressed?

J. Jones

Verified customer

Asked: 2013-07-16

Answer

From what I have seen in literature, cervix carcinoma erythroleukemia does express AGO2. Generally AGO2 expresses in cytoplasm, p-body. Regarding which tissues have AGO2 expression, here are a few articles citing expression in various tissues:
Brain, and Eye, Pubmed ID: 15489334
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163

Boster Scientific Support

Answered: 2013-07-16

Order DetailsPrice
PB9978

100μg

$370
PB9978-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
PB9978-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
PB9978-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
PB9978-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
PB9978-APC

100 μg APC conjugated (liquid)

$820
PB9978-FITC

100 μg FITC conjugated (liquid)

$570
PB9978-Cy3

100 μg Cy3 conjugated (liquid)

$570
PB9978-Biotin

100 μg Biotin conjugated (liquid)

$570
PB9978-HRP

100 μg HRP conjugated (liquid)

$570
PB9978-PE

100 μg PE conjugated (liquid)

$820
PB9978-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9978
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: May 1, 2026