Anti-ATF6 Antibody Picoband™

Boster Bio Anti-ATF6 Antibody Picoband™ catalog # A00655. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A00655
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Product Name

Anti-ATF6 Antibody Picoband™

See all ATF6 products

SKU/Catalog Number

A00655

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-ATF6 Antibody Picoband™ catalog # A00655. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-ATF6 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00655)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human ATF6 (597-629aa AININENVINGQDYEVMMQIDCQVMDTRILHIK), different from the related mouse and rat sequences by one amino acid.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

A00655 is reactive to ATF6 in Human, Mouse, Rat

Applications

A00655 is guaranteed for IHC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat

Validation Images & Assay Conditions

Gene/Protein Information For ATF6 (Source: Uniprot.Org, NCBI)

Uniprot ID

P18850

Gene ID

22926

Gene Name

ATF6

Full Name

Cyclic AMP-dependent transcription factor ATF-6 alpha

Weight

74.585kDa

Superfamily

bZIP family

Alternative Names

ACHM7; Activating transcription factor 6 alpha; activating transcription factor 6; atf6 a; ATF6 alpha; ATF6; ATF6A; ATF6-alpha; cAMP-dependent transcription factor ATF-6 alpha; cyclic AMP-dependent transcription factor ATF-6 alpha ATF6 ACHM7A, ATF6 activating transcription factor 6 cyclic AMP-dependent transcription factor ATF-6 alpha|cAMP-dependent transcription factor ATF-6 alpha

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on ATF6, check out the ATF6 Infographic

ATF6 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for ATF6: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A00655

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-ATF6 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-ATF6 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

17 Customer Q&As for Anti-ATF6 Antibody Picoband™

Question

I was wanting to use your anti-ATF6 antibody for WB for mouse corpus epididymis on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse corpus epididymis identification?

Verified Customer

Verified customer

Asked: 2020-05-08

Answer

As indicated on the product datasheet, A00655 anti-ATF6 antibody has been tested for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse corpus epididymis in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-05-08

Question

I am interested in to test anti-ATF6 antibody A00655 on mouse corpus epididymis for research purposes, then I may be interested in using anti-ATF6 antibody A00655 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2020-04-24

Answer

The products we sell, including anti-ATF6 antibody A00655, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2020-04-24

Question

We have observed staining in human cervix carcinoma. Any tips? Is anti-ATF6 antibody supposed to stain cervix carcinoma positively?

J. Bhatt

Verified customer

Asked: 2020-03-05

Answer

From literature cervix carcinoma does express ATF6. From Uniprot.org, ATF6 is expressed in corpus epididymis, cervix carcinoma, pancreas, among other tissues. Regarding which tissues have ATF6 expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 9271374, 9837962
Pancreas, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2020-03-05

Question

We have tried in the past anti-ATF6 antibody for IHC on pancreas a few years ago. I am using rat, and We intend to use the antibody for WB next. you antibody examining pancreas as well as corpus epididymis in our next experiment. Do you have any suggestion on which antibody would work the best for WB?

Verified Customer

Verified customer

Asked: 2019-12-11

Answer

I looked at the website and datasheets of our anti-ATF6 antibody and I see that A00655 has been tested on rat in both IHC and WB. Thus A00655 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in rat even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2019-12-11

Question

Does A00655 anti-ATF6 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2019-06-13

Answer

It shows on the product datasheet, A00655 anti-ATF6 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-06-13

Question

My colleagues were well pleased with the WB result of your anti-ATF6 antibody. However we have been able to see positive staining in pancreas endoplasmic reticulum membrane using this antibody. Is that expected? Could you tell me where is ATF6 supposed to be expressed?

K. Miller

Verified customer

Asked: 2018-10-31

Answer

From literature, pancreas does express ATF6. Generally ATF6 expresses in endoplasmic reticulum membrane. Regarding which tissues have ATF6 expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 9271374, 9837962
Pancreas, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2018-10-31

Question

Will anti-ATF6 antibody A00655 work for WB with corpus epididymis?

C. Thomas

Verified customer

Asked: 2018-08-30

Answer

According to the expression profile of corpus epididymis, ATF6 is highly expressed in corpus epididymis. So, it is likely that anti-ATF6 antibody A00655 will work for WB with corpus epididymis.

Boster Scientific Support

Answered: 2018-08-30

Question

Is this A00655 anti-ATF6 antibody reactive to the isotypes of ATF6?

Verified Customer

Verified customer

Asked: 2018-08-13

Answer

The immunogen of A00655 anti-ATF6 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human ATF6 (597-629aa AININENVINGQDYEVMMQIDCQVMDTRILHIK), different from the related mouse and rat sequences by one amino acid. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2018-08-13

Question

Does anti-ATF6 antibody A00655 work on horse IHC with corpus epididymis?

Verified Customer

Verified customer

Asked: 2018-02-13

Answer

Our lab technicians have not validated anti-ATF6 antibody A00655 on horse. You can run a BLAST between horse and the immunogen sequence of anti-ATF6 antibody A00655 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated horse samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in horse corpus epididymis in IHC, you can get your next antibody for free.

Boster Scientific Support

Answered: 2018-02-13

Question

I see that the anti-ATF6 antibody A00655 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2018-02-08

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2018-02-08

Question

See attached the WB image, lot number and protocol we used for corpus epididymis using anti-ATF6 antibody A00655. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2018-01-29

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-01-29

Question

Is there a BSA free version of anti-ATF6 antibody A00655 available?

Verified Customer

Verified customer

Asked: 2017-10-09

Answer

Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-ATF6 antibody A00655 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2017-10-09

Question

Is a blocking peptide available for product anti-ATF6 antibody (A00655)?

Verified Customer

Verified customer

Asked: 2017-08-17

Answer

We do provide the blocking peptide for product anti-ATF6 antibody (A00655). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2017-08-17

Question

I am looking for using your anti-ATF6 antibody for regulation of transcription by rna polymerase ii studies. Has this antibody been tested with western blotting on mouse liver tissue? We would like to see some validation images before ordering.

D. Mangal

Verified customer

Asked: 2016-12-23

Answer

I appreciate your inquiry. This A00655 anti-ATF6 antibody is validated on rat liver tissue, mouse liver tissue. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2016-12-23

Question

Can you help my question with product A00655, anti-ATF6 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

R. Moore

Verified customer

Asked: 2016-12-02

Answer

We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00655 anti-ATF6 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2016-12-02

Question

We are currently using anti-ATF6 antibody A00655 for human tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on monkey tissues as well?

M. Collins

Verified customer

Asked: 2014-03-10

Answer

The anti-ATF6 antibody (A00655) has not been tested for cross reactivity specifically with monkey tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2014-03-10

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for corpus epididymis using anti-ATF6 antibody A00655. Let me know if you need anything else.

O. Taylor

Verified customer

Asked: 2013-09-23

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2013-09-23

Conjugation

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
A00655
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$280.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.