Anti-ATF4 Antibody Picoband®

ATF4 antibody

Boster Bio Anti-ATF4 Antibody Picoband® catalog # A00371-1. Tested in IHC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 1 publication(s).

Product Info Summary

SKU: A00371-1
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: IHC, WB

Product Name

Anti-ATF4 Antibody Picoband®

View all ATF4 Antibodies

SKU/Catalog Number

A00371-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-ATF4 Antibody Picoband® catalog # A00371-1. Tested in IHC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-ATF4 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00371-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human ATF4, which shares 97.6% amino acid (aa) sequence identity with both mouse and rat ATF4.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A00371-1 is reactive to ATF4 in Human

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

50 kDa

Calculated molecular weight

38590 MW

Background of ATF4

ATF4, Activating Transcription Factor 4, is also known as CREB2. ATF4 belongs to the large ATF/CREB family of transcription factors which bind DNA via their basic region and dimerize via their leucine zipper domain to form a variety of homo- and heterodimers to regulate gene transcription. It is identified that members of this family share significant sequence similarity within a leucine zipper DNA-binding motif and an adjacent basic region. The ATF4 gene is mapped to chromosome 22. Unlike CREB, which activates transcription from CRE-containing promoters, CREB2 functions as a specific repressor of CRE-dependent transcription. The transcriptional repressor activity resides within the C-terminal leucine zipper and basic domain region of the CREB2 protein.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A00371-1 is guaranteed for IHC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml

Positive Control

WB: human SW620 whole cell, human Hela whole cell
IHC: human ovary cancer tissue, human prostatic cancer tissue

Validation Images & Assay Conditions

Gene/Protein Information For ATF4 (Source: Uniprot.org, NCBI)

Gene Name

ATF4

Full Name

Cyclic AMP-dependent transcription factor ATF-4

Weight

38590 MW

Superfamily

bZIP family

Alternative Names

Cyclic AMP-dependent transcription factor ATF-4; cAMP-dependent transcription factor ATF-4; Activating transcription factor 4; Cyclic AMP-responsive element-binding protein 2; CREB-2; cAMP-responsive element-binding protein 2; DNA-binding protein TAXREB67; Tax-responsive enhancer element-binding protein 67; TaxREB67; ATF4; CREB2; TXREB ATF4 CREB-2, CREB2, TAXREB67, TXREB activating transcription factor 4 cyclic AMP-dependent transcription factor ATF-4|DNA-binding protein TAXREB67|cAMP response element-binding protein 2|cAMP-dependent transcription factor ATF-4|cAMP-responsive element-binding protein 2|cyclic AMP-responsive element-binding protein 2|tax-responsive enhancer element B67|tax-responsive enhancer element-binding protein 67

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on ATF4, check out the ATF4 Infographic

ATF4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ATF4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

A00371-1 has been cited in 1 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

MARVELD1 Inhibits Nonsense-Mediated RNA Decay by Repressing Serine Phosphorylation of UPF1

Have you used Anti-ATF4 Antibody Picoband®?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-ATF4 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

8 Customer Q&As for Anti-ATF4 Antibody Picoband®

Question

Is this A00371-1 anti-ATF4 antibody reactive to the isotypes of ATF4?

Verified Customer

Verified customer

Asked: 2020-04-03

Answer

The immunogen of A00371-1 anti-ATF4 antibody is A synthetic peptide corresponding to a sequence of human ATF4 (KELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-04-03

Question

We ordered your anti-ATF4 antibody for WB on colon last year. I am using human, and I plan to use the antibody for IHC next. We need examining colon as well as fibroblast in our next experiment. Do you have any suggestion on which antibody would work the best for IHC?

Verified Customer

Verified customer

Asked: 2020-02-27

Answer

I looked at the website and datasheets of our anti-ATF4 antibody and I see that A00371-1 has been tested on human in both WB and IHC. Thus A00371-1 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2020-02-27

Question

I was wanting to use your anti-ATF4 antibody for WB for human colon on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human colon identification?

C. Parker

Verified customer

Asked: 2020-02-05

Answer

You can see on the product datasheet, A00371-1 anti-ATF4 antibody has been validated for IHC, WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human colon in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-02-05

Question

My question regards to test anti-ATF4 antibody A00371-1 on human colon for research purposes, then I may be interested in using anti-ATF4 antibody A00371-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-10-24

Answer

The products we sell, including anti-ATF4 antibody A00371-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-10-24

Question

We are currently using anti-ATF4 antibody A00371-1 for human tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human. Is it possible that the antibody can work on feline tissues as well?

Verified Customer

Verified customer

Asked: 2019-07-03

Answer

The anti-ATF4 antibody (A00371-1) has not been tested for cross reactivity specifically with feline tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-07-03

Question

We want using your anti-ATF4 antibody for response to manganese-induced endoplasmic reticulum stress studies. Has this antibody been tested with western blotting on hela whole cell lysates? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2018-12-04

Answer

I appreciate your inquiry. This A00371-1 anti-ATF4 antibody is validated on human placenta tissue, hela whole cell lysates, hepg2 whole cell lysates, sw620 whole cell lysates, prostatic cancer tissue, ovary cancer tissue. It is guaranteed to work for IHC, WB in human. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2018-12-04

Question

We have been able to see staining in human fibroblast. Are there any suggestions? Is anti-ATF4 antibody supposed to stain fibroblast positively?

Verified Customer

Verified customer

Asked: 2018-08-09

Answer

According to literature fibroblast does express ATF4. According to Uniprot.org, ATF4 is expressed in lower esophagus, fibroblast, leukemic t-cell, colon, lung, placenta urinary bladder, cervix carcinoma, among other tissues. Regarding which tissues have ATF4 expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 20068231
Colon, Lung, Placenta, and Urinary bladder, Pubmed ID: 15489334
Fibroblast, Pubmed ID: 1847461
Leukemic T-cell, Pubmed ID: 1534408

Boster Scientific Support

Answered: 2018-08-09

Question

My colleagues were satisfied with the WB result of your anti-ATF4 antibody. However we have observed positive staining in cervix carcinoma cytoplasm. using this antibody. Is that expected? Could you tell me where is ATF4 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2017-09-28

Answer

From what I have seen in literature, cervix carcinoma does express ATF4. Generally ATF4 expresses in cytoplasm. Regarding which tissues have ATF4 expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 20068231
Colon, Lung, Placenta, and Urinary bladder, Pubmed ID: 15489334
Fibroblast, Pubmed ID: 1847461
Leukemic T-cell, Pubmed ID: 1534408

Boster Scientific Support

Answered: 2017-09-28

Order DetailsPrice
A00371-1

100μg

$370
A00371-1-10ug

10μg sample (liquid)

$99
A00371-1-Biotin

100 μg Biotin conjugated

$570
A00371-1-Cy3

100 μg Cy3 conjugated

$570
A00371-1-Dylight488

100 μg Dylight488 conjugated

$570
A00371-1-Dylight550

100 μg Dylight550 conjugated

$570
A00371-1-Dylight594

100 μg Dylight594 conjugated

$570
A00371-1-FITC

100 μg FITC conjugated

$570
A00371-1-HRP

100 μg HRP conjugated

$570
A00371-1-APC

100 μg APC conjugated

$670
A00371-1-PE

100 μg PE conjugated

$670
A00371-1-iFluor647

100 μg iFluor647 conjugated

$670
A00371-1-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A00371-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.