Product Info Summary
SKU: | A00371-1 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human |
Host: | Rabbit |
Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-ATF4 Antibody Picoband®
SKU/Catalog Number
A00371-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-ATF4 Antibody Picoband® catalog # A00371-1. Tested in IHC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-ATF4 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00371-1)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human ATF4, which shares 97.6% amino acid (aa) sequence identity with both mouse and rat ATF4.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A00371-1 is reactive to ATF4 in Human
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
50 kDa
Calculated molecular weight
38590 MW
Background of ATF4
ATF4, Activating Transcription Factor 4, is also known as CREB2. ATF4 belongs to the large ATF/CREB family of transcription factors which bind DNA via their basic region and dimerize via their leucine zipper domain to form a variety of homo- and heterodimers to regulate gene transcription. It is identified that members of this family share significant sequence similarity within a leucine zipper DNA-binding motif and an adjacent basic region. The ATF4 gene is mapped to chromosome 22. Unlike CREB, which activates transcription from CRE-containing promoters, CREB2 functions as a specific repressor of CRE-dependent transcription. The transcriptional repressor activity resides within the C-terminal leucine zipper and basic domain region of the CREB2 protein.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A00371-1 is guaranteed for IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Positive Control
WB: human SW620 whole cell, human Hela whole cell
IHC: human ovary cancer tissue, human prostatic cancer tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of ATF4 using anti-ATF4 antibody (A00371-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human SW620 whole cell lysates,
Lane 2: human Hela whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-ATF4 antigen affinity purified polyclonal antibody (Catalog # A00371-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for ATF4 at approximately 50 kDa. The expected band size for ATF4 is at 39 kDa.
Click image to see more details
Figure 2. IHC analysis of ATF4 using anti-ATF4 antibody (A00371-1).
ATF4 was detected in paraffin-embedded section of human ovary cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-ATF4 Antibody (A00371-1) overnight at 4℃. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37℃. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of ATF4 using anti-ATF4 antibody (A00371-1).
ATF4 was detected in paraffin-embedded section of human prostatic cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-ATF4 Antibody (A00371-1) overnight at 4℃. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37℃. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Protein Target Info & Infographic
Gene/Protein Information For ATF4 (Source: Uniprot.org, NCBI)
Gene Name
ATF4
Full Name
Cyclic AMP-dependent transcription factor ATF-4
Weight
38590 MW
Superfamily
bZIP family
Alternative Names
Cyclic AMP-dependent transcription factor ATF-4; cAMP-dependent transcription factor ATF-4; Activating transcription factor 4; Cyclic AMP-responsive element-binding protein 2; CREB-2; cAMP-responsive element-binding protein 2; DNA-binding protein TAXREB67; Tax-responsive enhancer element-binding protein 67; TaxREB67; ATF4; CREB2; TXREB ATF4 CREB-2, CREB2, TAXREB67, TXREB activating transcription factor 4 cyclic AMP-dependent transcription factor ATF-4|DNA-binding protein TAXREB67|cAMP response element-binding protein 2|cAMP-dependent transcription factor ATF-4|cAMP-responsive element-binding protein 2|cyclic AMP-responsive element-binding protein 2|tax-responsive enhancer element B67|tax-responsive enhancer element-binding protein 67
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on ATF4, check out the ATF4 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for ATF4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-ATF4 Antibody Picoband® (A00371-1)
Hello CJ!
A00371-1 has been cited in 1 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
MARVELD1 Inhibits Nonsense-Mediated RNA Decay by Repressing Serine Phosphorylation of UPF1
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-ATF4 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-ATF4 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
8 Customer Q&As for Anti-ATF4 Antibody Picoband®
Question
Is this A00371-1 anti-ATF4 antibody reactive to the isotypes of ATF4?
Verified Customer
Verified customer
Asked: 2020-04-03
Answer
The immunogen of A00371-1 anti-ATF4 antibody is A synthetic peptide corresponding to a sequence of human ATF4 (KELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-04-03
Question
We ordered your anti-ATF4 antibody for WB on colon last year. I am using human, and I plan to use the antibody for IHC next. We need examining colon as well as fibroblast in our next experiment. Do you have any suggestion on which antibody would work the best for IHC?
Verified Customer
Verified customer
Asked: 2020-02-27
Answer
I looked at the website and datasheets of our anti-ATF4 antibody and I see that A00371-1 has been tested on human in both WB and IHC. Thus A00371-1 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC detection and you can check out our website bosterbio.com to find out more information about them.
Boster Scientific Support
Answered: 2020-02-27
Question
I was wanting to use your anti-ATF4 antibody for WB for human colon on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human colon identification?
C. Parker
Verified customer
Asked: 2020-02-05
Answer
You can see on the product datasheet, A00371-1 anti-ATF4 antibody has been validated for IHC, WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human colon in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2020-02-05
Question
My question regards to test anti-ATF4 antibody A00371-1 on human colon for research purposes, then I may be interested in using anti-ATF4 antibody A00371-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2019-10-24
Answer
The products we sell, including anti-ATF4 antibody A00371-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-10-24
Question
We are currently using anti-ATF4 antibody A00371-1 for human tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human. Is it possible that the antibody can work on feline tissues as well?
Verified Customer
Verified customer
Asked: 2019-07-03
Answer
The anti-ATF4 antibody (A00371-1) has not been tested for cross reactivity specifically with feline tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-07-03
Question
We want using your anti-ATF4 antibody for response to manganese-induced endoplasmic reticulum stress studies. Has this antibody been tested with western blotting on hela whole cell lysates? We would like to see some validation images before ordering.
Verified Customer
Verified customer
Asked: 2018-12-04
Answer
I appreciate your inquiry. This A00371-1 anti-ATF4 antibody is validated on human placenta tissue, hela whole cell lysates, hepg2 whole cell lysates, sw620 whole cell lysates, prostatic cancer tissue, ovary cancer tissue. It is guaranteed to work for IHC, WB in human. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2018-12-04
Question
We have been able to see staining in human fibroblast. Are there any suggestions? Is anti-ATF4 antibody supposed to stain fibroblast positively?
Verified Customer
Verified customer
Asked: 2018-08-09
Answer
According to literature fibroblast does express ATF4. According to Uniprot.org, ATF4 is expressed in lower esophagus, fibroblast, leukemic t-cell, colon, lung, placenta urinary bladder, cervix carcinoma, among other tissues. Regarding which tissues have ATF4 expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 20068231
Colon, Lung, Placenta, and Urinary bladder, Pubmed ID: 15489334
Fibroblast, Pubmed ID: 1847461
Leukemic T-cell, Pubmed ID: 1534408
Boster Scientific Support
Answered: 2018-08-09
Question
My colleagues were satisfied with the WB result of your anti-ATF4 antibody. However we have observed positive staining in cervix carcinoma cytoplasm. using this antibody. Is that expected? Could you tell me where is ATF4 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2017-09-28
Answer
From what I have seen in literature, cervix carcinoma does express ATF4. Generally ATF4 expresses in cytoplasm. Regarding which tissues have ATF4 expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 20068231
Colon, Lung, Placenta, and Urinary bladder, Pubmed ID: 15489334
Fibroblast, Pubmed ID: 1847461
Leukemic T-cell, Pubmed ID: 1534408
Boster Scientific Support
Answered: 2017-09-28