Anti-Bcl-X/BCL2L1 Antibody Picoband™

Boster Bio Anti-Bcl-X/BCL2L1 Antibody Picoband™ catalog # PB9917. Tested in Flow Cytometry, IHC, ICC, WB applications. This antibody reacts with Human. Cited in 3 publication(s).

Product Info Summary

SKU: PB9917
Size: 100μg/vial
Reactive Species: Human
Host: Rabbit
Application: Flow Cytometry, IHC, ICC, WB

Product Name

Anti-Bcl-X/BCL2L1 Antibody Picoband™

See all BCL2L1 products

SKU/Catalog Number

PB9917

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Bcl-X/BCL2L1 Antibody Picoband™ catalog # PB9917. Tested in Flow Cytometry, IHC, ICC, WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Bcl-X/BCL2L1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9917)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human Bcl-X (75-105aa LDAREVIPMAAVKQALREAGDEFELRYRRAF), identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

PB9917 is reactive to BCL2L1 in Human

Applications

PB9917 is guaranteed for Flow Cytometry, IHC, ICC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human
Immunohistochemistry (Frozen Section), 0.5-1μg/ml, Human
Immunocytochemistry, 0.5-1μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For BCL2L1 (Source: Uniprot.Org, NCBI)

Uniprot ID

Q07817

Gene ID

598

Gene Name

BCL2L1

Full Name

Bcl-2-like protein 1

Weight

26.049kDa

Superfamily

Bcl-2 family

Alternative Names

Apoptosis regulator Bcl-X; bcl2-L-1; BCL2-like 1; bcl-2-like protein 1; BCLXBCL2LBcl-X; BclxL; Bcl-xL; BCL-XL/S; BCLXS; bcl-xS; DKFZp781P2092 BCL2L1 BCL-XL/S, BCL2L, BCLX, Bcl-X, PPP1R52 BCL2 like 1 bcl-2-like protein 1|apoptosis regulator Bcl-X|protein phosphatase 1, regulatory subunit 52

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on BCL2L1, check out the BCL2L1 Infographic

BCL2L1 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for BCL2L1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

PB9917 has been cited in 3 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Relationship between Egr-1 gene expression and apoptosis in esophageal carcinoma and precancerous lesions

Emodin alleviates severe acute pancreatitis-associated acute lung injury by decreasing pre-B-cell colony-enhancing factor expression and promoting polymorphonuclear neutrophil apoptosis

Zhou X, Zhang Y, Li Y, Hao X, Liu X, Wang Y. Cancers (Basel). 2012 Dec 4;4(4):1318-32. Doi: 10.3390/Cancers4041318. Azithromycin Synergistically Enhances Anti-Proliferative Activity Of Vincristine In Cervical And Gastric Cancer Cells.

Have you used Anti-Bcl-X/BCL2L1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Bcl-X/BCL2L1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

16 Customer Q&As for Anti-Bcl-X/BCL2L1 Antibody Picoband™

Question

Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for lung using anti-Bcl-X/BCL2L1 antibody PB9917. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2020-04-03

Answer

I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-04-03

Question

Will anti-Bcl-X/BCL2L1 antibody PB9917 work for Flow Cytometry with lung?

Verified Customer

Verified customer

Asked: 2020-03-19

Answer

According to the expression profile of lung, BCL2L1 is highly expressed in lung. So, it is likely that anti-Bcl-X/BCL2L1 antibody PB9917 will work for Flow Cytometry with lung.

Boster Scientific Support

Answered: 2020-03-19

Question

Would PB9917 anti-Bcl-X/BCL2L1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2020-02-20

Answer

It shows on the product datasheet, PB9917 anti-Bcl-X/BCL2L1 antibody as been validated on Flow Cytometry. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2020-02-20

Question

I see that the anti-Bcl-X/BCL2L1 antibody PB9917 works with Flow Cytometry, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-11-13

Answer

You can find protocols for Flow Cytometry on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-11-13

Question

Is a blocking peptide available for product anti-Bcl-X/BCL2L1 antibody (PB9917)?

Verified Customer

Verified customer

Asked: 2019-10-17

Answer

We do provide the blocking peptide for product anti-Bcl-X/BCL2L1 antibody (PB9917). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-10-17

Question

Here is the WB image, lot number and protocol we used for lung using anti-Bcl-X/BCL2L1 antibody PB9917. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-09-25

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-09-25

Question

Do you have a BSA free version of anti-Bcl-X/BCL2L1 antibody PB9917 available?

F. Miller

Verified customer

Asked: 2019-09-16

Answer

Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-Bcl-X/BCL2L1 antibody PB9917 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-09-16

Question

We have been able to see staining in human upper lobe of left lung. What should we do? Is anti-Bcl-X/BCL2L1 antibody supposed to stain upper lobe of left lung positively?

Verified Customer

Verified customer

Asked: 2019-07-31

Answer

From literature upper lobe of left lung does express BCL2L1. From Uniprot.org, BCL2L1 is expressed in upper lobe of left lung, colon carcinoma, lung, among other tissues. Regarding which tissues have BCL2L1 expression, here are a few articles citing expression in various tissues:
Colon carcinoma, Pubmed ID: 17974005
Lung, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2019-07-31

Question

We were content with the WB result of your anti-Bcl-X/BCL2L1 antibody. However we have observed positive staining in colon carcinoma isoform bcl-x(l): mitochondrion inner using this antibody. Is that expected? Could you tell me where is BCL2L1 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2019-07-16

Answer

From what I have seen in literature, colon carcinoma does express BCL2L1. Generally BCL2L1 expresses in isoform bcl-x(l): mitochondrion inner. Regarding which tissues have BCL2L1 expression, here are a few articles citing expression in various tissues:
Colon carcinoma, Pubmed ID: 17974005
Lung, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2019-07-16

Question

We are currently using anti-Bcl-X/BCL2L1 antibody PB9917 for human tissue, and we are content with the IHC results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on horse tissues as well?

E. Wu

Verified customer

Asked: 2019-06-28

Answer

The anti-Bcl-X/BCL2L1 antibody (PB9917) has not been validated for cross reactivity specifically with horse tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-06-28

Question

I was wanting to use your anti-Bcl-X/BCL2L1 antibody for Flow Cytometry for human lung on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human lung identification?

Verified Customer

Verified customer

Asked: 2019-05-17

Answer

You can see on the product datasheet, PB9917 anti-Bcl-X/BCL2L1 antibody has been tested for Flow Cytometry, IHC, ICC, WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human lung in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-05-17

Question

My lab would like using your anti-Bcl-X/BCL2L1 antibody for fertilization studies. Has this antibody been tested with western blotting on a549 cells? We would like to see some validation images before ordering.

N. Jackson

Verified customer

Asked: 2018-09-17

Answer

Thank you for your inquiry. This PB9917 anti-Bcl-X/BCL2L1 antibody is tested on sw620 whole cell lysates, a549 cells. It is guaranteed to work for Flow Cytometry, IHC, ICC, WB in human. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2018-09-17

Question

Our lab want to know about to test anti-Bcl-X/BCL2L1 antibody PB9917 on human lung for research purposes, then I may be interested in using anti-Bcl-X/BCL2L1 antibody PB9917 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2018-08-30

Answer

The products we sell, including anti-Bcl-X/BCL2L1 antibody PB9917, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2018-08-30

Question

I have a question about product PB9917, anti-Bcl-X/BCL2L1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2018-08-03

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9917 anti-Bcl-X/BCL2L1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2018-08-03

Question

Is this PB9917 anti-Bcl-X/BCL2L1 antibody reactive to the isotypes of BCL2L1?

N. Evans

Verified customer

Asked: 2016-01-27

Answer

The immunogen of PB9917 anti-Bcl-X/BCL2L1 antibody is A synthetic peptide corresponding to a sequence in the middle region of human Bcl-X (75-105aa LDAREVIPMAAVKQALREAGDEFELRYRRAF), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2016-01-27

Question

Our lab used your anti-Bcl-X/BCL2L1 antibody for IHC on colon carcinoma in a previous experiment. I am using human, and We are going to use the antibody for Flow Cytometry next. We need examining colon carcinoma as well as upper lobe of left lung in our next experiment. Do you have any suggestion on which antibody would work the best for Flow Cytometry?

O. Williams

Verified customer

Asked: 2015-02-12

Answer

I looked at the website and datasheets of our anti-Bcl-X/BCL2L1 antibody and it appears that PB9917 has been validated on human in both IHC and Flow Cytometry. Thus PB9917 should work for your application. Our Boster satisfaction guarantee will cover this product for Flow Cytometry in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for Flow Cytometry detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2015-02-12

Conjugation

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
PB9917
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$280.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.