Anti-Cytochrome P450 2D6/CYP2D6 Antibody Picoband™

Boster Bio Anti-Cytochrome P450 2D6/CYP2D6 Antibody Picoband™ catalog # A00498-1. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A00498-1
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Product Name

Anti-Cytochrome P450 2D6/CYP2D6 Antibody Picoband™

See all Cytochrome P450 2D6 products

SKU/Catalog Number







Boster Bio Anti-Cytochrome P450 2D6/CYP2D6 Antibody Picoband™ catalog # A00498-1. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Cytochrome P450 2D6/CYP2D6 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00498-1)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence at the C-terminus of human Cytochrome P450 2D6 (315-347aa AWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEM).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

A00498-1 is reactive to CYP2D6 in Human, Mouse, Rat


A00498-1 is guaranteed for IHC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Western blot, 0.1-0.5μg/ml, Mouse, Rat, Human

Validation Images & Assay Conditions

Gene/Protein Information For CYP2D6 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Cytochrome P450 2D6




cytochrome P450 family

Alternative Names

CPD6P450DB1; CYP2D; CYP2D7AP; CYP2D7BP; CYP2D7P2; CYP2D8P2; CYP2DL1; CYPIID6; cytochrome P450 2D6; cytochrome P450, family 2, subfamily D, polypeptide 6; cytochrome P450, family 2, subfamily D, polypeptide 7 pseudogene 2; cytochrome P450, family 2, subfamily D, polypeptide 8 pseudogene 2; cytochrome P450, subfamily II (debrisoquine, sparteine, etc., -metabolising); cytochrome P450, subfamily IID (debrisoquine, sparteine, etc.; cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolising); cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolizing); Cytochrome CYP2D6 CPD6, CYP2D, CYP2D7AP, CYP2D7BP, CYP2D7P2, CYP2D8P2, CYP2DL1, CYPIID6, P450-DB1, P450C2D, P450DB1 cytochrome P450 family 2 subfamily D member 6 cytochrome P450 2D6|cholesterol 25-hydroxylase|cytochrome P450, family 2, subfamily D, polypeptide 6|cytochrome P450, family 2, subfamily D, polypeptide 7 pseudogene 2|cytochrome P450, family 2, subfamily D, polypeptide 8 pseudogene 2|cytochrome P450, subfamily II (debrisoquine, sparteine, etc., -metabolising), polypeptide 7 pseudogene 2|cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolising), polypeptide 8 pseudogene 2|cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolizing), polypeptide 6|cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolizing)-like 1|cytochrome P450-DB1|debrisoquine 4-hydroxylase|flavoprotein-linked monooxygenase|microsomal monooxygenase|nonfunctional cytochrome P450 2D6|xenobiotic monooxygenase

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on CYP2D6, check out the CYP2D6 Infographic

CYP2D6 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for CYP2D6: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A00498-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Cytochrome P450 2D6/CYP2D6 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Cytochrome P450 2D6/CYP2D6 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

1 Customer Q&As for Anti-Cytochrome P450 2D6/CYP2D6 Antibody Picoband™


We are currently using anti-Cytochrome P450 2D6/CYP2D6 antibody A00498-1 for rat tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on feline tissues as well?

J. Krishna

Verified customer

Asked: 2015-07-14


The anti-Cytochrome P450 2D6/CYP2D6 antibody (A00498-1) has not been tested for cross reactivity specifically with feline tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2015-07-14



Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.