Anti-EIF2C1/AGO1 Antibody Picoband™

AGO1/EIF2C1 antibody

Boster Bio Anti-EIF2C1/AGO1 Antibody Picoband™ catalog # A00826-1. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A00826-1
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IF, IHC, ICC, WB

Product Name

Anti-EIF2C1/AGO1 Antibody Picoband™

View all AGO1/EIF2C1 Antibodies

SKU/Catalog Number







Boster Bio Anti-EIF2C1/AGO1 Antibody Picoband™ catalog # A00826-1. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-EIF2C1/AGO1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00826-1)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence in the middle region of human EIF2C1/AGO1 (376-409aa EISRLMKNASYNLDPYIQEFGIKVKDDMTEVTGR), identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

A00826-1 is reactive to AGO1 in Human, Mouse, Rat


A00826-1 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee

Background of AGO1/EIF2C1

This gene encodes a member of the argonaute family of proteins, which associate with small RNAs and have important roles in RNA interference (RNAi) and RNA silencing. This protein binds to microRNAs (miRNAs) or small interfering RNAs (siRNAs) and represses translation of mRNAs that are complementary to them. It is also involved in transcriptional gene silencing (TGS) of promoter regions that are complementary to bound short antigene RNAs (agRNAs), as well as in the degradation of miRNA-bound mRNA targets. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. A recent study showed this gene to be an authentic stop codon readthrough target, and that its mRNA could give rise to an additional C-terminally extended isoform by use of an alternative in-frame translation termination codon.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Rat, By Heat
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For AGO1 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Protein argonaute-1




argonaute family

Alternative Names

AGO1Q99; argonaute 1; argonaute1; DKFZp686M13167; eIF2C 1; eIF-2C 1; EIF2C; Eukaryotic translation initiation factor 2C 1; eukaryotic translation initiation factor 2C, 1; GERP95; Golgi Endoplasmic Reticulum protein 95 kDa; hAgo1; protein argonaute-1; Putative RNA-binding protein Q99 AGO1 EIF2C, EIF2C1, GERP95, Q99, hAgo1 argonaute RISC component 1 protein argonaute-1|Golgi Endoplasmic Reticulum protein 95 kDa|argonaute 1, RISC catalytic component|argonaute RISC catalytic component 1|argonaute1|eIF-2C 1|eIF2C 1|eukaryotic translation initiation factor 2C, 1|putative RNA-binding protein Q99

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on AGO1, check out the AGO1 Infographic

AGO1 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for AGO1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A00826-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-EIF2C1/AGO1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-EIF2C1/AGO1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

5 Customer Q&As for Anti-EIF2C1/AGO1 Antibody Picoband™


Will A00826-1 anti-EIF2C1/AGO1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

S. Brown

Verified customer

Asked: 2020-04-14


You can see on the product datasheet, A00826-1 anti-EIF2C1/AGO1 antibody as been tested on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2020-04-14


Is a blocking peptide available for product anti-EIF2C1/AGO1 antibody (A00826-1)?

Verified Customer

Verified customer

Asked: 2020-02-06


We do provide the blocking peptide for product anti-EIF2C1/AGO1 antibody (A00826-1). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2020-02-06


Will anti-EIF2C1/AGO1 antibody A00826-1 work for IHC with prostate gland?

Verified Customer

Verified customer

Asked: 2019-08-26


According to the expression profile of prostate gland, AGO1 is highly expressed in prostate gland. So, it is likely that anti-EIF2C1/AGO1 antibody A00826-1 will work for IHC with prostate gland.

Boster Scientific Support

Answered: 2019-08-26


I see that the anti-EIF2C1/AGO1 antibody A00826-1 works with IHC, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2017-11-24


You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2017-11-24


We are currently using anti-EIF2C1/AGO1 antibody A00826-1 for mouse tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on zebrafish tissues as well?

W. Baker

Verified customer

Asked: 2013-05-01


The anti-EIF2C1/AGO1 antibody (A00826-1) has not been validated for cross reactivity specifically with zebrafish tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2013-05-01


how to order through PO


Total: $315



Ask a question

Get A Quote

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

Product Categories

Primary Antibodies

Primary and Secondary Antibodies

Boster Bio offers over 16,000 antibodies that have been validated for IHC, WB, ELISA, and FC in human, mouse, and rat samples. Rabbit and mouse monoclonal antibodies as well as rabbit polyclonal antibodies are available. Buy a primary antibody and get a secondary antibody for free!



More than 1,000 ELISA kits, both singleplex and multiplex, that have been cited 6,000+ times are available at Boster. We offer our Boster-branded Picokine™ ELISA kits (sandwich ELISA) and EZ-Set™ ELISA kits (DIY antibody pairs) in addition to many multiplex ELISA kits.


Recombinant Proteins

Boster provides a wide range of human, mouse, and rat recombinant proteins, which include cytokines, growth factors, chemokines, and many more. Our recombinant proteins have high stability, biological activity, and purity.

Boster Kit


Boster offers all the reagents you need for your immunostaining and western blotting experiments. We've got everything from buffers to lysates to kits, including our popular and well-cited BCA, CCK-8, and MTT assay kits.

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.