Product Info Summary
SKU: | A00826-1 |
---|---|
Size: | 100μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | Flow Cytometry, IF, IHC, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-EIF2C1/AGO1 Antibody Picoband™
View all AGO1/EIF2C1 Antibodies
SKU/Catalog Number
A00826-1
Size
100μg/vial
Form
Lyophilized
Description
Boster Bio Anti-EIF2C1/AGO1 Antibody Picoband™ catalog # A00826-1. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-EIF2C1/AGO1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00826-1)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human EIF2C1/AGO1 (376-409aa EISRLMKNASYNLDPYIQEFGIKVKDDMTEVTGR), identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross Reactivity
No cross reactivity with other proteins
Reactive Species
A00826-1 is reactive to AGO1 in Human, Mouse, Rat
Applications
A00826-1 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee
Background of AGO1/EIF2C1
This gene encodes a member of the argonaute family of proteins, which associate with small RNAs and have important roles in RNA interference (RNAi) and RNA silencing. This protein binds to microRNAs (miRNAs) or small interfering RNAs (siRNAs) and represses translation of mRNAs that are complementary to them. It is also involved in transcriptional gene silencing (TGS) of promoter regions that are complementary to bound short antigene RNAs (agRNAs), as well as in the degradation of miRNA-bound mRNA targets. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. A recent study showed this gene to be an authentic stop codon readthrough target, and that its mRNA could give rise to an additional C-terminally extended isoform by use of an alternative in-frame translation termination codon.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists world wide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Rat, By Heat
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human
Validation Images & Assay Conditions

Click image to see more details
Figure 1. Western blot analysis of EIF2C1/AGO1 using anti-EIF2C1/AGO1 antibody (A00826-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat brain tissue lysates,
Lane 2: rat kidney tissue lysates,
Lane 3: NRK whole Cell lysates,
Lane 4: mouse brain tissue lysates,
Lane 5: mouse kidney tissue lysates,
Lane 6: HELA whole cell lysates,
Lane 7: JURKAT whole cell lysates,
Lane 8: K562 whole cell lysates,
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-EIF2C1/AGO1 antigen affinity purified polyclonal antibody (Catalog # A00826-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for EIF2C1/AGO1 at approximately 97KD. The expected band size for EIF2C1/AGO1 is at 97KD.

Click image to see more details
Figure 2. IHC analysis of EIF2C1/AGO1 using anti-EIF2C1/AGO1 antibody (A00826-1).
EIF2C1/AGO1 was detected in paraffin-embedded section of rat lung tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-EIF2C1/AGO1 Antibody (A00826-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.

Click image to see more details
Figure 3. IHC analysis of EIF2C1/AGO1 using anti-EIF2C1/AGO1 antibody (A00826-1).
EIF2C1/AGO1 was detected in paraffin-embedded section of rat spleen tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-EIF2C1/AGO1 Antibody (A00826-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.

Click image to see more details
Figure 4. IHC analysis of EIF2C1/AGO1 using anti-EIF2C1/AGO1 antibody (A00826-1).
EIF2C1/AGO1 was detected in paraffin-embedded section of human mammary cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-EIF2C1/AGO1 Antibody (A00826-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1022) with DAB as the chromogen.

Click image to see more details
Figure 5. Flow Cytometry analysis of HL-60 cells using anti-EIF2C1/AGO1 antibody (A00826-1).
Overlay histogram showing HL-60 cells stained with A00826-1 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-EIF2C1/AGO1 Antibody (A00826-1,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.

Click image to see more details
Figure 6. IF analysis of AGO1 using anti-AGO1 antibody (A00826-1).
AGO1 was detected in immunocytochemical section of U20S cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 2μg/mL rabbit anti-AGO1 Antibody (A00826-1) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG (BA1127) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Protein Target Info & Infographic
Gene/Protein Information For AGO1 (Source: Uniprot.Org, NCBI)
Uniprot ID
Q9UL18
Gene ID
26523
Gene Name
AGO1
Full Name
Protein argonaute-1
Weight
97.214kDa
Superfamily
argonaute family
Alternative Names
AGO1Q99; argonaute 1; argonaute1; DKFZp686M13167; eIF2C 1; eIF-2C 1; EIF2C; Eukaryotic translation initiation factor 2C 1; eukaryotic translation initiation factor 2C, 1; GERP95; Golgi Endoplasmic Reticulum protein 95 kDa; hAgo1; protein argonaute-1; Putative RNA-binding protein Q99 AGO1 EIF2C, EIF2C1, GERP95, Q99, hAgo1 argonaute RISC component 1 protein argonaute-1|Golgi Endoplasmic Reticulum protein 95 kDa|argonaute 1, RISC catalytic component|argonaute RISC catalytic component 1|argonaute1|eIF-2C 1|eIF2C 1|eukaryotic translation initiation factor 2C, 1|putative RNA-binding protein Q99
*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".For more info on AGO1, check out the AGO1 Infographic

We have 30,000+ of these available, one for each gene! check them out.
In this infographic you will see the following information for AGO1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]
Specific Publications For Anti-EIF2C1/AGO1 Antibody Picoband™ (A00826-1)
No publications found for A00826-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-EIF2C1/AGO1 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Submit A Review
Be the first to review Anti-EIF2C1/AGO1 Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
5 Customer Q&As for Anti-EIF2C1/AGO1 Antibody Picoband™
Question
Will A00826-1 anti-EIF2C1/AGO1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
S. Brown
Verified customer
Asked: 2020-04-14
Answer
You can see on the product datasheet, A00826-1 anti-EIF2C1/AGO1 antibody as been tested on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2020-04-14
Question
Is a blocking peptide available for product anti-EIF2C1/AGO1 antibody (A00826-1)?
Verified Customer
Verified customer
Asked: 2020-02-06
Answer
We do provide the blocking peptide for product anti-EIF2C1/AGO1 antibody (A00826-1). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2020-02-06
Question
Will anti-EIF2C1/AGO1 antibody A00826-1 work for IHC with prostate gland?
Verified Customer
Verified customer
Asked: 2019-08-26
Answer
According to the expression profile of prostate gland, AGO1 is highly expressed in prostate gland. So, it is likely that anti-EIF2C1/AGO1 antibody A00826-1 will work for IHC with prostate gland.
Boster Scientific Support
Answered: 2019-08-26
Question
I see that the anti-EIF2C1/AGO1 antibody A00826-1 works with IHC, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2017-11-24
Answer
You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2017-11-24
Question
We are currently using anti-EIF2C1/AGO1 antibody A00826-1 for mouse tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on zebrafish tissues as well?
W. Baker
Verified customer
Asked: 2013-05-01
Answer
The anti-EIF2C1/AGO1 antibody (A00826-1) has not been validated for cross reactivity specifically with zebrafish tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2013-05-01