Overview
Product Name |
Anti-GAD65/GAD2 Antibody Picoband™ (monoclonal, 7G2)
See more GAD2/GAD65 products |
Catalog# |
M03142 |
Pack Size |
100μg/vial |
Storage & Handling |
At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquoted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing. |
Description |
Mouse IgG monoclonal antibody for GAD65/GAD2 detection. Tested with WB, IHC-P, ICC/IF, FCM in Human;Mouse;Rat. |
Cite This Product |
Anti-GAD65/GAD2 Antibody Picoband™ (monoclonal, 7G2) (Boster Biological Technology, Pleasanton CA, USA, Catalog # M03142)
|
Antibodies Validation |
Antibodies Validation Information
|
Product Specs
Host |
Mouse |
Reactive Species |
Human, Mouse, Rat |
Applications |
Flow Cytometry, IF, IHC-P, ICC, WB
*Our Boster Guarantee covers the use of this product in the above
tested applications.
*Innovating Scientists reward: if you test this antibody on a species or application not listed above and share with us your results, we will provide you a full credit to purchase Boster products. |
Related Products |
Boster recommends Enhanced Chemiluminescent Kit with anti-Mouse IgG (EK1001) for Western blot, and HRP Conjugated anti-Mouse IgG Super Vision Assay Kit (SV0001-1) for IHC(P) and ICC.
*Blocking peptide can be purchased at $100. Contact us for more information.
**Boster also offers various secondary antibodies for Immunoflourescecne and IHC. Take advantage of the buy 1 primary antibody get 1 secondary antibody for free promotion all year round. |
Immunogen |
A synthetic peptide corresponding to a sequence at the N-terminus of human GAD65 (131-164aa KVIDFHYPNELLQEYNWELADQPQNLEEILMHCQ), different from the related mouse and rat sequences by one amino acid. |
Gene/Protein Basic Information For GAD2 (Source: Uniprot.org, NCBI)
Uniprot Id | Q05329 |
---|
NCBI Gene Id | 2572 |
---|
Species Of This Entry | Human |
---|
Gene Name | GAD2 |
---|
Protein Name | Glutamate decarboxylase 2 |
---|
Superfamily | group II decarboxylase family |
---|
Alternative Names | GAD2/GAD65|EC 4.1.1; EC 4.1.1.15; GAD2; GAD65; GAD-65; GAD65MGC161605; glutamate decarboxylase 2 (pancreatic islets and brain, 65kD); glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa); glutamate decarboxylase 2; Glutamate decarboxylase 65 kDa isoform; Glutamate decarboxylase-2 (pancreas); MGC161607,65 kDa glutamic acid decarboxylase |
---|
Molecular Weight | 65411 |
---|
*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".
For more info on GAD2, check out the GAD2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
Want a nice infographic on your next protein? Boster's got them all. All proteins in the human genome, and some, can be found in the Boster Bio gene infographics. Download it and share it with your colleagues and friends. Big size posters available upon request.
In this infographic you will see the following information for GAD2: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. Some times it even contains some opt-ed articles the Boster team on the scientific news and clinical impacts of this protein, though not all have that. Too many proteins, you know.
Take me to the GAD2 infographic
Our Boster Quality Guarantee for Anti-GAD65/GAD2 Antibody Picoband™ (monoclonal, 7G2) covers its use in the following applications.
Western blot, 0.1-0.5μg/ml, Mouse, Rat
Immunohistochemistry(Paraffin-embedded Section), 0.5-1μg/ml, Human
Immunocytochemistry/Immunofluorescence, 4μg/ml, Human
Flow Cytometry, 1-3μg/1x10
6 cells, Human
*The recommended dilution ratios/concentrations are for reference only and optimal dilutions/concentrations should be determined by the end user.

Figure 1. Western blot analysis of GAD65/GAD2 using anti-GAD65/GAD2 antibody (M03142).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat brain tissue lysates,
Lane 2: mouse brain tissue lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-GAD65/GAD2 antigen affinity purified monoclonal antibody (Catalog # M03142) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1001) with Tanon 5200 system. A specific band was detected for GAD65/GAD2 at approximately 62KD. The expected band size for GAD65/GAD2 is at 62KD.
Figure 2. IHC analysis of GAD65/GAD2 using anti-GAD65/GAD2 antibody (M03142).
GAD65/GAD2 was detected in paraffin-embedded section of human glioma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml mouse anti-GAD65/GAD2 Antibody (M03142) overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) (Catalog # SA1021) with DAB as the chromogen.
Figure 3. IF analysis of GAD65/GAD2 using anti- GAD65/GAD2 antibody (M03142).
GAD65/GAD2 was detected in immunocytochemical section of Hela cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 4μg/mL mouse anti- GAD65/GAD2 Antibody (M03142) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Mouse IgG (BA1126) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Figure 4. Flow Cytometry analysis of U20S cells using anti- GAD65/GAD2 antibody (M03142).
Overlay histogram showing U20S cells stained with M03142 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-GAD65/GAD2 Antibody (M03142, 1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-mouse IgG (BA1126, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was mouse IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Figure 5. Flow Cytometry analysis of 293T cells using anti- GAD65/GAD2 antibody (M03142).
Overlay histogram showing 293T cells stained with M03142 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-GAD65/GAD2 Antibody (M03142, 1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-mouse IgG (BA1126, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was mouse IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Specific Protocols
Boster provides comprehensive technical information for WB, IHC/IF/ICC, Flow Cytometry sample preparation protocols, assay protocols, troubleshooting tips and assay optimization tips.
Did You Know ?
That Boster Bio offers comprehensive selection of Western blot and IHC reagents? Great quality and save up to 50% cost.
Other Recommended Resources
Here are featured tools and databases that you might find useful.
Total number of citations: 1
Gut microbe-derived metabolite trimethylamine N-oxide induces cardiac hypertrophy and fibrosis
Zehua Li, et al.
Lab Invest. 2019 Mar;99(3):346-357. doi: 10.1038/s41374-018-0091-y. Epub 2018 Aug 1. |
PubMed ID 30068915 |
|
0 reviews
Contact us with any questions at [email protected] or go to contact us
Questions and answers from customers related to M03142 Anti-GAD65/GAD2 Antibody Picoband™ (monoclonal, 7G2)
0 Related Questions