Anti-Myelin oligodendrocyte glycoprotein/MOG Antibody Picoband™

MOG antibody

Boster Bio Anti-Myelin oligodendrocyte glycoprotein/MOG Antibody Picoband™ catalog # A03294. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A03294
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IHC, WB

Product Name

Anti-Myelin oligodendrocyte glycoprotein/MOG Antibody Picoband™

View all MOG Antibodies

SKU/Catalog Number







Boster Bio Anti-Myelin oligodendrocyte glycoprotein/MOG Antibody Picoband™ catalog # A03294. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Myelin oligodendrocyte glycoprotein/MOG Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A03294)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence of human Myelin oligodendrocyte glycoprotein/MOG (RVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGK).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A03294 is reactive to MOG in Human, Mouse, Rat


A03294 is guaranteed for Flow Cytometry, IHC, WB Boster Guarantee

Background of MOG

Myelin oligodendrocyte glycoprotein (MOG) is a glycoprotein believed to be important in the myelination of nerves in the central nervous system (CNS). In humans this protein is encoded by the MOG gene. This gene is mapped to 6p22.1. It is speculated to serve as a necessary "adhesion molecule" to provide structural integrity to the myelin sheath and is known to develop late on the oligodendrocyte. The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Flow Cytometry, 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For MOG (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Myelin-oligodendrocyte glycoprotein




immunoglobulin superfamily

Alternative Names

MGC26137; MOG Ig-AluB; MOG; MOGIG2; myelin oligodendrocyte glycoprotein; myelin-oligodendrocyte glycoprotein MOG BTN6, BTNL11IG2, NRCLP7, MOG myelin oligodendrocyte glycoprotein myelin-oligodendrocyte glycoprotein|MOG AluA|MOG AluB|MOG Ig-AluB|MOG alpha-5

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on MOG, check out the MOG Infographic

MOG infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for MOG: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A03294

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Myelin oligodendrocyte glycoprotein/MOG Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Myelin oligodendrocyte glycoprotein/MOG Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

18 Customer Q&As for Anti-Myelin oligodendrocyte glycoprotein/MOG Antibody Picoband™


Can you verify if A03294 works in ICC?

Verified customer

Asked: 2020-11-06


The Anti-Myelin Oligodendrocyte Glycoprotein/MOG Antibody Picoband™ (A03294) has been validated for Flow Cytometry, IHC-P, WB. It has not been validated for ICC, so there's no guarantee that it would work.

Boster Scientific Support

Answered: 2020-11-06


I was wanting to use your anti-Myelin oligodendrocyte glycoprotein/MOG antibody for IHC-P for rat brain cortex on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for rat brain cortex identification?

Verified Customer

Verified customer

Asked: 2020-04-20


It shows on the product datasheet, A03294 anti-Myelin oligodendrocyte glycoprotein/MOG antibody has been validated for Flow Cytometry, IHC-P, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat brain cortex in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-04-20


We are currently using anti-Myelin oligodendrocyte glycoprotein/MOG antibody A03294 for mouse tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on dog tissues as well?

Verified Customer

Verified customer

Asked: 2020-02-27


The anti-Myelin oligodendrocyte glycoprotein/MOG antibody (A03294) has not been tested for cross reactivity specifically with dog tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-02-27


My lab would like using your anti-Myelin oligodendrocyte glycoprotein/MOG antibody for narcolepsy 7 (nrclp7) studies. Has this antibody been tested with western blotting on rat brain tissue? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2020-02-18


We appreciate your inquiry. This A03294 anti-Myelin oligodendrocyte glycoprotein/MOG antibody is tested on rat brain tissue, mouse brain, u251 cells. It is guaranteed to work for Flow Cytometry, IHC-P, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2020-02-18


My question regarding product A03294, anti-Myelin oligodendrocyte glycoprotein/MOG antibody . I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-12-25


We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A03294 anti-Myelin oligodendrocyte glycoprotein/MOG antibody , we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-12-25


We are currently using anti-Myelin oligodendrocyte glycoprotein/MOG antibody A03294 for mouse tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on dog tissues as well?

Verified Customer

Verified customer

Asked: 2019-09-20


The anti-Myelin oligodendrocyte glycoprotein/MOG antibody (A03294) has not been tested for cross reactivity specifically with dog tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-09-20


See below the WB image, lot number and protocol we used for brain cortex using anti-Myelin oligodendrocyte glycoprotein/MOG antibody A03294. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-08-22


Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-08-22


We ordered your anti-Myelin oligodendrocyte glycoprotein/MOG antibody for Flow Cytometry on brain cortex a few months ago. I am using human, and We are going to use the antibody for IHC-P next. My question regards examining brain cortex as well as c1 segment of cervical spinal cord in our next experiment. Could give a recommendation on which antibody would work the best for IHC-P?

Verified Customer

Verified customer

Asked: 2019-06-24


I looked at the website and datasheets of our anti-Myelin oligodendrocyte glycoprotein/MOG antibody and it seems that A03294 has been tested on human in both Flow Cytometry and IHC-P. Thus A03294 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC-P in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC-P detection and you can check out our website to find out more information about them.

Boster Scientific Support

Answered: 2019-06-24


We have been able to see staining in mouse brain. What should we do? Is anti-Myelin oligodendrocyte glycoprotein/MOG antibody supposed to stain brain positively?

Verified Customer

Verified customer

Asked: 2018-08-08


Based on literature brain does express MOG. Based on, MOG is expressed in c1 segment of cervical spinal cord, brain, brain cortex, among other tissues. Regarding which tissues have MOG expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 7964757, 15489334
Brain cortex, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2018-08-08


Is a blocking peptide available for product anti-Myelin oligodendrocyte glycoprotein/MOG antibody (A03294)?

Verified Customer

Verified customer

Asked: 2018-05-30


We do provide the blocking peptide for product anti-Myelin oligodendrocyte glycoprotein/MOG antibody (A03294). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2018-05-30


Is there a BSA free version of anti-Myelin oligodendrocyte glycoprotein/MOG antibody A03294 available?

Verified Customer

Verified customer

Asked: 2018-03-27


We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Myelin oligodendrocyte glycoprotein/MOG antibody A03294 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2018-03-27


Is this A03294 anti-Myelin oligodendrocyte glycoprotein/MOG antibody reactive to the isotypes of MOG?

Verified Customer

Verified customer

Asked: 2018-01-24


The immunogen of A03294 anti-Myelin oligodendrocyte glycoprotein/MOG antibody is A synthetic peptide corresponding to a sequence of human Myelin oligodendrocyte glycoprotein/MOG (RVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGK). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2018-01-24


We need to test anti-Myelin oligodendrocyte glycoprotein/MOG antibody A03294 on rat brain cortex for research purposes, then I may be interested in using anti-Myelin oligodendrocyte glycoprotein/MOG antibody A03294 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2017-12-18


The products we sell, including anti-Myelin oligodendrocyte glycoprotein/MOG antibody A03294, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2017-12-18


My boss were satisfied with the WB result of your anti-Myelin oligodendrocyte glycoprotein/MOG antibody . However we have observed positive staining in brain cortex isoform 1: cell membrane using this antibody. Is that expected? Could you tell me where is MOG supposed to be expressed?

Verified Customer

Verified customer

Asked: 2017-08-02


From what I have seen in literature, brain cortex does express MOG. Generally MOG expresses in isoform 1: cell membrane. Regarding which tissues have MOG expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 7964757, 15489334
Brain cortex, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2017-08-02


Will anti-Myelin oligodendrocyte glycoprotein/MOG antibody A03294 work for IHC-P with brain cortex?

S. Thomas

Verified customer

Asked: 2017-05-31


According to the expression profile of brain cortex, MOG is highly expressed in brain cortex. So, it is likely that anti-Myelin oligodendrocyte glycoprotein/MOG antibody A03294 will work for IHC-P with brain cortex.

Boster Scientific Support

Answered: 2017-05-31


Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for brain cortex using anti-Myelin oligodendrocyte glycoprotein/MOG antibody A03294. Let me know if you need anything else.

S. Wu

Verified customer

Asked: 2015-09-21


Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2015-09-21


Will A03294 anti-Myelin oligodendrocyte glycoprotein/MOG antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

K. Kulkarni

Verified customer

Asked: 2014-11-14


You can see on the product datasheet, A03294 anti-Myelin oligodendrocyte glycoprotein/MOG antibody as been tested on IHC-P. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2014-11-14


I see that the anti-Myelin oligodendrocyte glycoprotein/MOG antibody A03294 works with IHC-P, what is the protocol used to produce the result images on the product page?

Z. Jha

Verified customer

Asked: 2013-01-24


You can find protocols for IHC-P on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2013-01-24


how to order through PO


Total: $315



Ask a question

Get A Quote

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

Product Categories

Primary Antibodies

Primary and Secondary Antibodies

Boster Bio offers over 16,000 antibodies that have been validated for IHC, WB, ELISA, and FC in human, mouse, and rat samples. Rabbit and mouse monoclonal antibodies as well as rabbit polyclonal antibodies are available. Buy a primary antibody and get a secondary antibody for free!



More than 1,000 ELISA kits, both singleplex and multiplex, that have been cited 6,000+ times are available at Boster. We offer our Boster-branded Picokine™ ELISA kits (sandwich ELISA) and EZ-Set™ ELISA kits (DIY antibody pairs) in addition to many multiplex ELISA kits.


Recombinant Proteins

Boster provides a wide range of human, mouse, and rat recombinant proteins, which include cytokines, growth factors, chemokines, and many more. Our recombinant proteins have high stability, biological activity, and purity.

Boster Kit


Boster offers all the reagents you need for your immunostaining and western blotting experiments. We've got everything from buffers to lysates to kits, including our popular and well-cited BCA, CCK-8, and MTT assay kits.

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.