Anti-nmt55/p54nrb/NONO Antibody Picoband™

NONO antibody

Boster Bio Anti-nmt55/p54nrb/NONO Antibody Picoband™ catalog # PB9875. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: PB9875
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IF, IHC, ICC, WB

Customers Who Bought This Also Bought

Product Name

Anti-nmt55/p54nrb/NONO Antibody Picoband™

View all NONO Antibodies

SKU/Catalog Number

PB9875

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-nmt55/p54nrb/NONO Antibody Picoband™ catalog # PB9875. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-nmt55/p54nrb/NONO Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9875)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human nmt55/p54nrb, identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

PB9875 is reactive to NONO in Human, Mouse, Rat

Applications

PB9875 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee

Observed Molecular Weight

60 kDa

Calculated molecular weight

54.232kDa

Background of NONO

Non-POU domain-containing octamer-binding protein is a protein that in humans is encoded by the NONO gene. This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16. 

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For NONO (Source: Uniprot.org, NCBI)

Gene Name

NONO

Full Name

Non-POU domain-containing octamer-binding protein

Weight

54.232kDa

Alternative Names

NMT5552 kDa subunit; non-POU domain containing, octamer-binding; NRB54non-POU-domain-containing, octamer-binding; p54(nrb) NONO MRXS34, NMT55, NRB54, P54, P54NRB, PPP1R114 non-POU domain containing octamer binding non-POU domain-containing octamer-binding protein|54 kDa nuclear RNA- and DNA-binding protein|55 kDa nuclear protein|DNA-binding p52/p100 complex, 52 kDa subunit|non-POU domain-containing octamer (ATGCAAAT) binding protein|p54(nrb)|protein phosphatase 1, regulatory subunit 114

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on NONO, check out the NONO Infographic

NONO infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NONO: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for PB9875

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-nmt55/p54nrb/NONO Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-nmt55/p54nrb/NONO Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

6 Customer Q&As for Anti-nmt55/p54nrb/NONO Antibody Picoband™

Question

We are currently using anti-nmt55/p54nrb/NONO antibody PB9875 for mouse tissue, and we are content with the Flow Cytometry results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on horse tissues as well?

Verified Customer

Verified customer

Asked: 2020-03-04

Answer

The anti-nmt55/p54nrb/NONO antibody (PB9875) has not been validated for cross reactivity specifically with horse tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-03-04

Question

Does anti-nmt55/p54nrb/NONO antibody PB9875 work for WB with cervix carcinoma erythroleukemia?

Verified Customer

Verified customer

Asked: 2019-12-23

Answer

According to the expression profile of cervix carcinoma erythroleukemia, NONO is highly expressed in cervix carcinoma erythroleukemia. So, it is likely that anti-nmt55/p54nrb/NONO antibody PB9875 will work for WB with cervix carcinoma erythroleukemia.

Boster Scientific Support

Answered: 2019-12-23

Question

Is this PB9875 anti-nmt55/p54nrb/NONO antibody reactive to the isotypes of NONO?

Verified Customer

Verified customer

Asked: 2019-11-28

Answer

The immunogen of PB9875 anti-nmt55/p54nrb/NONO antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human nmt55/p54nrb (1-35aa MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQ), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-11-28

Question

I was wanting to use your anti-nmt55/p54nrb/NONO antibody for WB for human cervix carcinoma erythroleukemia on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human cervix carcinoma erythroleukemia identification?

L. Dhar

Verified customer

Asked: 2016-06-07

Answer

You can see on the product datasheet, PB9875 anti-nmt55/p54nrb/NONO antibody has been tested for Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human cervix carcinoma erythroleukemia in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2016-06-07

Question

Is a blocking peptide available for product anti-nmt55/p54nrb/NONO antibody (PB9875)?

J. Jha

Verified customer

Asked: 2015-08-19

Answer

We do provide the blocking peptide for product anti-nmt55/p54nrb/NONO antibody (PB9875). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2015-08-19

Question

Can you help my question with product PB9875, anti-nmt55/p54nrb/NONO antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

S. Wu

Verified customer

Asked: 2015-04-21

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9875 anti-nmt55/p54nrb/NONO antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2015-04-21

Order DetailsPrice
PB9875

100μg

$370
PB9875-10ug

10μg sample (liquid)

$99
PB9875-Biotin

100 μg Biotin conjugated

$570
PB9875-Cy3

100 μg Cy3 conjugated

$570
PB9875-Dylight488

100 μg Dylight488 conjugated

$570
PB9875-Dylight550

100 μg Dylight550 conjugated

$570
PB9875-Dylight594

100 μg Dylight594 conjugated

$570
PB9875-FITC

100 μg FITC conjugated

$570
PB9875-HRP

100 μg HRP conjugated

$570
PB9875-APC

100 μg APC conjugated

$670
PB9875-PE

100 μg PE conjugated

$670
PB9875-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
Eddy test
In stock
Order Product
PB9875
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.