Product Info Summary
SKU: | A00033-2 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Notch1 Antibody Picoband™
SKU/Catalog Number
A00033-2
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Notch1 Antibody Picoband™ catalog # A00033-2. Tested in WB applications. This antibody reacts with Human, Mouse.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Notch1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00033-2)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Notch1, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A00033-2 is reactive to NOTCH1 in Human, Mouse
Applications
A00033-2 is guaranteed for WB Boster Guarantee
Observed Molecular Weight
272 kDa
Calculated molecular weight
272.505kDa
Background of NOTCH1
Notch proteins are single-pass transmembrane receptors that regulate cell fate decisions during development. The Notch family includes 4 receptors, NOTCH1, NOTCH2, NOTCH3, and NOTCH4, whose ligands include JAG1, JAG2, DLL1, DLL3, and DLL4. Notch homolog 1, translocation-associated (NOTCH1), is a human gene encoding a single-pass transmembrane receptor. It functions as a receptor for membrane bound ligands, and may play multiple roles during development. NOTCH1 may normally coordinates the process of somitogenesis, and the activated Notch 1 and Notch 3 promote differentiation of progenitor cells into astroglia.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Mouse, Human
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of Notch1 using anti-Notch1 antibody (A00033-2).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: mouse skeletal muscle tissue lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Notch1 antigen affinity purified polyclonal antibody (Catalog # A00033-2) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Notch1 at approximately 272KD. The expected band size for Notch1 is at 272KD.
Protein Target Info & Infographic
Gene/Protein Information For NOTCH1 (Source: Uniprot.org, NCBI)
Gene Name
NOTCH1
Full Name
Neurogenic locus notch homolog protein 1
Weight
272.505kDa
Superfamily
NOTCH family
Alternative Names
EC 2.1.2.11; EC 3.4.21.68; hN1; Notch (Drosophila) homolog 1 (translocation-associated); notch 1Notch homolog 1, translocation-associated (Drosophila); Notch homolog 1, translocation-associated; Notch1; Notch-1; TAN1; TAN1neurogenic locus notch homolog protein 1; Translocation-associated notch protein TAN-1 NOTCH1 AOS5, AOVD1, TAN1, hN1 notch receptor 1 neurogenic locus notch homolog protein 1|Notch homolog 1, translocation-associated|notch 1|translocation-associated notch protein TAN-1
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on NOTCH1, check out the NOTCH1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for NOTCH1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Notch1 Antibody Picoband™ (A00033-2)
Hello CJ!
A00033-2 has been cited in 1 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Involvement of Notch2 in all%u2011trans retinoic acid%u2011induced inhibition of mouse embryonic palate mesenchymal cell proliferation
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Notch1 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Notch1 Antibody Picoband™
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
15 Customer Q&As for Anti-Notch1 Antibody Picoband™
Question
I see that the anti-Notch1 antibody A00033-2 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2020-04-01
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2020-04-01
Question
Is there a BSA free version of anti-Notch1 antibody A00033-2 available?
Verified Customer
Verified customer
Asked: 2020-02-25
Answer
Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-Notch1 antibody A00033-2 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2020-02-25
Question
Is this A00033-2 anti-Notch1 antibody reactive to the isotypes of NOTCH1?
Verified Customer
Verified customer
Asked: 2020-01-23
Answer
The immunogen of A00033-2 anti-Notch1 antibody is A synthetic peptide corresponding to a sequence in the middle region of human Notch1 (1797-1827aa LKNASDGALMDDNQNEWGDEDLETKKFRFEE), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-01-23
Question
Is a blocking peptide available for product anti-Notch1 antibody (A00033-2)?
Verified Customer
Verified customer
Asked: 2019-12-26
Answer
We do provide the blocking peptide for product anti-Notch1 antibody (A00033-2). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-12-26
Question
We have observed staining in mouse visceral pleura. Are there any suggestions? Is anti-Notch1 antibody supposed to stain visceral pleura positively?
Verified Customer
Verified customer
Asked: 2019-11-26
Answer
From literature visceral pleura does express NOTCH1. From Uniprot.org, NOTCH1 is expressed in visceral pleura, brain, aortic endothelium, cervix carcinoma, among other tissues. Regarding which tissues have NOTCH1 expression, here are a few articles citing expression in various tissues:
Aortic endothelium, Pubmed ID: 17573339
Brain, Pubmed ID: 15164053
Cervix carcinoma, Pubmed ID: 18669648
Boster Scientific Support
Answered: 2019-11-26
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for cervix carcinoma using anti-Notch1 antibody A00033-2. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-02-11
Answer
We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-02-11
Question
I have attached the WB image, lot number and protocol we used for cervix carcinoma using anti-Notch1 antibody A00033-2. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2018-10-10
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-10-10
Question
My question regards using your anti-Notch1 antibody for negative regulation of transcription by rna polymerase ii studies. Has this antibody been tested with western blotting on mouse skeletal muscle tissue? We would like to see some validation images before ordering.
A. Jones
Verified customer
Asked: 2018-08-27
Answer
Thank you for your inquiry. This A00033-2 anti-Notch1 antibody is tested on mouse skeletal muscle tissue, tissue lysate. It is guaranteed to work for WB in human, mouse. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.
Boster Scientific Support
Answered: 2018-08-27
Question
We are currently using anti-Notch1 antibody A00033-2 for mouse tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human, mouse. Is it true that the antibody can work on feline tissues as well?
Verified Customer
Verified customer
Asked: 2018-04-18
Answer
The anti-Notch1 antibody (A00033-2) has not been validated for cross reactivity specifically with feline tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2018-04-18
Question
Would A00033-2 anti-Notch1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2018-01-17
Answer
As indicated on the product datasheet, A00033-2 anti-Notch1 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2018-01-17
Question
Would anti-Notch1 antibody A00033-2 work for WB with cervix carcinoma?
P. Li
Verified customer
Asked: 2017-04-25
Answer
According to the expression profile of cervix carcinoma, NOTCH1 is highly expressed in cervix carcinoma. So, it is likely that anti-Notch1 antibody A00033-2 will work for WB with cervix carcinoma.
Boster Scientific Support
Answered: 2017-04-25
Question
Our team were happy with the WB result of your anti-Notch1 antibody. However we have observed positive staining in cervix carcinoma cell membrane using this antibody. Is that expected? Could you tell me where is NOTCH1 supposed to be expressed?
T. Jha
Verified customer
Asked: 2016-04-13
Answer
From what I have seen in literature, cervix carcinoma does express NOTCH1. Generally NOTCH1 expresses in cell membrane, notch 1 intracellular domain: nucleus. Regarding which tissues have NOTCH1 expression, here are a few articles citing expression in various tissues:
Aortic endothelium, Pubmed ID: 17573339
Brain, Pubmed ID: 15164053
Cervix carcinoma, Pubmed ID: 18669648
Boster Scientific Support
Answered: 2016-04-13
Question
I was wanting to use to test anti-Notch1 antibody A00033-2 on human cervix carcinoma for research purposes, then I may be interested in using anti-Notch1 antibody A00033-2 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
S. Roberts
Verified customer
Asked: 2015-08-18
Answer
The products we sell, including anti-Notch1 antibody A00033-2, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2015-08-18
Question
I was wanting to use your anti-Notch1 antibody for WB for human cervix carcinoma on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human cervix carcinoma identification?
C. Carter
Verified customer
Asked: 2014-03-20
Answer
As indicated on the product datasheet, A00033-2 anti-Notch1 antibody has been tested for WB on human, mouse tissues. We have an innovator award program that if you test this antibody and show it works in human cervix carcinoma in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2014-03-20
Question
I have a question about product A00033-2, anti-Notch1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
S. Mitchell
Verified customer
Asked: 2013-07-12
Answer
We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00033-2 anti-Notch1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2013-07-12