Product Info Summary
SKU: | A00348 |
---|---|
Size: | 100μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-PDGF beta/PDGFB Antibody Picoband™
SKU/Catalog Number
A00348
Size
100μg/vial
Form
Lyophilized
Description
Boster Bio Anti-PDGF beta/PDGFB Antibody Picoband™ catalog # A00348. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-PDGF beta/PDGFB Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00348)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human PDGF beta (89-129aa AEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQR), different from the related mouse and rat sequences by three amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross Reactivity
No cross reactivity with other proteins.
Reactive Species
A00348 is reactive to PDGFB in Human, Mouse, Rat
Applications
A00348 is guaranteed for WB Boster Guarantee
Background of PDGFB
Platelet-derived growth factor subunit B is a protein that in humans is encoded by the PDGFB gene. The protein encoded by this gene is a member of the platelet-derived growth factor family. This gene product can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. This gene is mapped to 22q13.1. Growth factor plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. This gene plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists world wide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Mouse, Rat, Human
Validation Images & Assay Conditions

Click image to see more details
Figure 1. Western blot analysis of PDGF beta using anti-PDGF beta antibody (A00348).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat brain tissue lysates,
Lane 2: mouse brain tissue lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-PDGF beta antigen affinity purified polyclonal antibody (Catalog # A00348) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for PDGF beta at approximately 27KD. The expected band size for PDGF beta is at 27KD.
Protein Target Info & Infographic
Gene/Protein Information For PDGFB (Source: Uniprot.Org, NCBI)
Uniprot ID
P01127
Gene ID
5155
Gene Name
PDGFB
Full Name
Platelet-derived growth factor subunit B
Weight
27.283kDa
Superfamily
PDGF/VEGF growth factor family
Alternative Names
PDGFBB; PDGF-BB PDGFB IBGC5, PDGF-2, PDGF2, SIS, SSV, c-sis platelet derived growth factor subunit B platelet-derived growth factor subunit B|PDGF subunit B|PDGF, B chain|becaplermin|epididymis secretory sperm binding protein|platelet-derived growth factor 2|platelet-derived growth factor B chain|platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog)|platelet-derived growth factor, beta polypeptide (oncogene SIS)|proto-oncogene c-Sis
*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".For more info on PDGFB, check out the PDGFB Infographic

We have 30,000+ of these available, one for each gene! check them out.
In this infographic you will see the following information for PDGFB: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]
Specific Publications For Anti-PDGF beta/PDGFB Antibody Picoband™ (A00348)
A00348 has been cited in 3 publications:
*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.
Investigation of the protective effect of erythropoietin on spinal cord injury in rats
Hong Z, Hong H, Chen H, Wang Z, Hong D. Exp Ther Med. 2011 Sep;2(5):837-841. Epub 2011 Jun 14. Investigation Of The Protective Effect Of Erythropoietin On Spinal Cord Injury In Rats.
Zhao Yj, Wang H, Liu X, Sun M, Kazuhiro H. Mol Med Rep. 2012 Oct;6(4):739-44. Doi: 10.3892/Mmr.2012.1007. Epub 2012 Jul 26. Protective Effects Of Glutamine In A Rat Model Of Endotoxemia.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-PDGF beta/PDGFB Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Submit A Review
Be the first to review Anti-PDGF beta/PDGFB Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question