Anti-PDGF beta/PDGFB Antibody Picoband™

PDGFB antibody

Boster Bio Anti-PDGF beta/PDGFB Antibody Picoband™ catalog # A00348. Tested in WB applications. This antibody reacts with Human, Mouse, Rat. Cited in 3 publication(s).

Product Info Summary

SKU: A00348
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Product Name

Anti-PDGF beta/PDGFB Antibody Picoband™

View all PDGFB Antibodies

SKU/Catalog Number







Boster Bio Anti-PDGF beta/PDGFB Antibody Picoband™ catalog # A00348. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-PDGF beta/PDGFB Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00348)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence at the C-terminus of human PDGF beta (89-129aa AEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQR), different from the related mouse and rat sequences by three amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A00348 is reactive to PDGFB in Human, Mouse, Rat


A00348 is guaranteed for WB Boster Guarantee

Background of PDGFB

Platelet-derived growth factor subunit B is a protein that in humans is encoded by the PDGFB gene. The protein encoded by this gene is a member of the platelet-derived growth factor family. This gene product can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. This gene is mapped to 22q13.1. Growth factor plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. This gene plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Mouse, Rat, Human

Validation Images & Assay Conditions

Gene/Protein Information For PDGFB (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Platelet-derived growth factor subunit B




PDGF/VEGF growth factor family

Alternative Names

PDGFBB; PDGF-BB PDGFB IBGC5, PDGF-2, PDGF2, SIS, SSV, c-sis platelet derived growth factor subunit B platelet-derived growth factor subunit B|PDGF subunit B|PDGF, B chain|becaplermin|epididymis secretory sperm binding protein|platelet-derived growth factor 2|platelet-derived growth factor B chain|platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog)|platelet-derived growth factor, beta polypeptide (oncogene SIS)|proto-oncogene c-Sis

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on PDGFB, check out the PDGFB Infographic

PDGFB infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for PDGFB: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

A00348 has been cited in 3 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Investigation of the protective effect of erythropoietin on spinal cord injury in rats

Hong Z, Hong H, Chen H, Wang Z, Hong D. Exp Ther Med. 2011 Sep;2(5):837-841. Epub 2011 Jun 14. Investigation Of The Protective Effect Of Erythropoietin On Spinal Cord Injury In Rats.

Zhao Yj, Wang H, Liu X, Sun M, Kazuhiro H. Mol Med Rep. 2012 Oct;6(4):739-44. Doi: 10.3892/Mmr.2012.1007. Epub 2012 Jul 26. Protective Effects Of Glutamine In A Rat Model Of Endotoxemia.

Have you used Anti-PDGF beta/PDGFB Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-PDGF beta/PDGFB Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Anti-PDGF beta/PDGFB Antibody Picoband™


how to order through PO


Total: $315



Ask a question

Get A Quote

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

Product Categories

Primary Antibodies

Primary and Secondary Antibodies

Boster Bio offers over 16,000 antibodies that have been validated for IHC, WB, ELISA, and FC in human, mouse, and rat samples. Rabbit and mouse monoclonal antibodies as well as rabbit polyclonal antibodies are available. Buy a primary antibody and get a secondary antibody for free!



More than 1,000 ELISA kits, both singleplex and multiplex, that have been cited 6,000+ times are available at Boster. We offer our Boster-branded Picokine™ ELISA kits (sandwich ELISA) and EZ-Set™ ELISA kits (DIY antibody pairs) in addition to many multiplex ELISA kits.


Recombinant Proteins

Boster provides a wide range of human, mouse, and rat recombinant proteins, which include cytokines, growth factors, chemokines, and many more. Our recombinant proteins have high stability, biological activity, and purity.

Boster Kit


Boster offers all the reagents you need for your immunostaining and western blotting experiments. We've got everything from buffers to lysates to kits, including our popular and well-cited BCA, CCK-8, and MTT assay kits.

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.