Anti-RRM2 Antibody Picoband™

RRM2 antibody

Boster Bio Anti-RRM2 Antibody Picoband™ catalog # PB9817. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. Cited in 1 publication(s).

Product Info Summary

SKU: PB9817
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Product Name

Anti-RRM2 Antibody Picoband™

View all RRM2 Antibodies

SKU/Catalog Number

PB9817

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-RRM2 Antibody Picoband™ catalog # PB9817. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-RRM2 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9817)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human RRM2, different from the related mouse and rat sequences by eight amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

PB9817 is reactive to RRM2 in Human, Mouse, Rat

Applications

PB9817 is guaranteed for IHC, WB Boster Guarantee

Observed Molecular Weight

50 kDa

Calculated molecular weight

44.878kDa

Background of RRM2

Ribonucleoside-diphosphate reductase subunit M2, also known as ribonucleotide reductase small subunit, is an enzyme that in humans is encoded by the RRM2 gene. It is mapped to 2p25-p24. This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms which differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat

Validation Images & Assay Conditions

Gene/Protein Information For RRM2 (Source: Uniprot.org, NCBI)

Gene Name

RRM2

Full Name

Ribonucleoside-diphosphate reductase subunit M2

Weight

44.878kDa

Superfamily

ribonucleoside diphosphate reductase small chain family

Alternative Names

EC 1.17.4.1; R2; ribonucleoside-diphosphate reductase subunit M2; ribonucleotide reductase M2 polypeptide; ribonucleotide reductase M2; Ribonucleotide reductase small chain; Ribonucleotide reductase small subunit; RR2; RR2M RRM2 C2orf48, R2, RR2, RR2M ribonucleotide reductase regulatory subunit M2 ribonucleoside-diphosphate reductase subunit M2|ribonucleotide reductase M2 polypeptide|ribonucleotide reductase small chain|ribonucleotide reductase small subunit|uncharacterized protein C2orf48

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on RRM2, check out the RRM2 Infographic

RRM2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RRM2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

PB9817 has been cited in 1 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Xu Lx, Li Zh, Tao Yf, Li Rh, Fang F, Zhao H, Li G, Li Yh, Wang J, Feng X, Pan J. J Exp Clin Cancer Res. 2014 Dec 19;33:108. Doi: 10.1186/S13046-014-0108-3. Histone Acetyltransferase Inhibitor Ii Induces Apoptosis In Glioma Cell Lines Via The P53 S...

Have you used Anti-RRM2 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Anti-RRM2 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

17 Customer Q&As for Anti-RRM2 Antibody Picoband™

Question

I have a question about product PB9817, anti-RRM2 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2020-05-06

Answer

It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9817 anti-RRM2 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2020-05-06

Question

We have tried in the past anti-RRM2 antibody for WB on leukemic t-cell last year. I am using human, and We are going to use the antibody for IHC next. Our lab want to know about examining leukemic t-cell as well as muscle skin in our next experiment. Could you please give me some suggestion on which antibody would work the best for IHC?

Verified Customer

Verified customer

Asked: 2020-04-24

Answer

I looked at the website and datasheets of our anti-RRM2 antibody and I see that PB9817 has been validated on human in both WB and IHC. Thus PB9817 should work for your application. Our Boster satisfaction guarantee will cover this product for IHC in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for IHC detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2020-04-24

Question

Is a blocking peptide available for product anti-RRM2 antibody (PB9817)?

Verified Customer

Verified customer

Asked: 2020-01-27

Answer

We do provide the blocking peptide for product anti-RRM2 antibody (PB9817). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2020-01-27

Question

See attached the WB image, lot number and protocol we used for cervix carcinoma using anti-RRM2 antibody PB9817. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2020-01-20

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-01-20

Question

My lab would like using your anti-RRM2 antibody for protein heterotetramerization studies. Has this antibody been tested with western blotting on mouse cardiac muscle tissue lysate? We would like to see some validation images before ordering.

A. Carter

Verified customer

Asked: 2019-12-02

Answer

We appreciate your inquiry. This PB9817 anti-RRM2 antibody is tested on rat cardiac muscle tissue lysate, mouse cardiac muscle tissue lysate, a431 whole cell lysate, hela whole cell lysate, mammary cancer tissue. It is guaranteed to work for IHC, WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2019-12-02

Question

We were happy with the WB result of your anti-RRM2 antibody. However we have observed positive staining in cervix carcinoma cytoplasm. using this antibody. Is that expected? Could you tell me where is RRM2 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2019-11-27

Answer

According to literature, cervix carcinoma does express RRM2. Generally RRM2 expresses in cytoplasm. Regarding which tissues have RRM2 expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 18691976, 20068231
Leukemic T-cell, Pubmed ID: 19690332
Mammary carcinoma, Pubmed ID: 1627826
Muscle, and Skin, Pubmed ID: 15489334
Neonatal skin, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2019-11-27

Question

I see that the anti-RRM2 antibody PB9817 works with IHC, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-11-19

Answer

You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-11-19

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for cervix carcinoma using anti-RRM2 antibody PB9817. Let me know if you need anything else.

E. Zhang

Verified customer

Asked: 2019-11-11

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-11-11

Question

Would anti-RRM2 antibody PB9817 work for IHC with cervix carcinoma?

Verified Customer

Verified customer

Asked: 2019-10-16

Answer

According to the expression profile of cervix carcinoma, RRM2 is highly expressed in cervix carcinoma. So, it is likely that anti-RRM2 antibody PB9817 will work for IHC with cervix carcinoma.

Boster Scientific Support

Answered: 2019-10-16

Question

We have observed staining in rat secondary oocyte. Are there any suggestions? Is anti-RRM2 antibody supposed to stain secondary oocyte positively?

Verified Customer

Verified customer

Asked: 2019-06-18

Answer

From what I have seen in literature secondary oocyte does express RRM2. From what I have seen in Uniprot.org, RRM2 is expressed in secondary oocyte, mammary carcinoma, neonatal skin, muscle skin, cervix carcinoma, leukemic t-cell, among other tissues. Regarding which tissues have RRM2 expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 18691976, 20068231
Leukemic T-cell, Pubmed ID: 19690332
Mammary carcinoma, Pubmed ID: 1627826
Muscle, and Skin, Pubmed ID: 15489334
Neonatal skin, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2019-06-18

Question

We are currently using anti-RRM2 antibody PB9817 for mouse tissue, and we are satisfied with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on horse tissues as well?

Verified Customer

Verified customer

Asked: 2019-06-13

Answer

The anti-RRM2 antibody (PB9817) has not been validated for cross reactivity specifically with horse tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-06-13

Question

Will anti-RRM2 antibody PB9817 work on feline WB with neonatal skin?

Verified Customer

Verified customer

Asked: 2019-01-29

Answer

Our lab technicians have not tested anti-RRM2 antibody PB9817 on feline. You can run a BLAST between feline and the immunogen sequence of anti-RRM2 antibody PB9817 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated feline samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in feline neonatal skin in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-01-29

Question

I am looking for to test anti-RRM2 antibody PB9817 on mouse cervix carcinoma for research purposes, then I may be interested in using anti-RRM2 antibody PB9817 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2018-05-25

Answer

The products we sell, including anti-RRM2 antibody PB9817, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2018-05-25

Question

Do you have a BSA free version of anti-RRM2 antibody PB9817 available?

D. Williams

Verified customer

Asked: 2018-03-12

Answer

I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-RRM2 antibody PB9817 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2018-03-12

Question

I was wanting to use your anti-RRM2 antibody for IHC for mouse cervix carcinoma on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for mouse cervix carcinoma identification?

Verified Customer

Verified customer

Asked: 2018-02-26

Answer

It shows on the product datasheet, PB9817 anti-RRM2 antibody has been tested for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse cervix carcinoma in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2018-02-26

Question

Is this PB9817 anti-RRM2 antibody reactive to the isotypes of RRM2?

Verified Customer

Verified customer

Asked: 2017-08-28

Answer

The immunogen of PB9817 anti-RRM2 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human RRM2 (1-33aa MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENT), different from the related mouse and rat sequences by eight amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2017-08-28

Question

Will PB9817 anti-RRM2 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

B. Taylor

Verified customer

Asked: 2014-11-10

Answer

You can see on the product datasheet, PB9817 anti-RRM2 antibody as been validated on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2014-11-10

Order DetailsPrice
PB9817

100μg

$370
PB9817-10ug

10μg sample (liquid)

$99
PB9817-Biotin

100 μg Biotin conjugated

$570
PB9817-Cy3

100 μg Cy3 conjugated

$570
PB9817-Dylight488

100 μg Dylight488 conjugated

$570
PB9817-Dylight550

100 μg Dylight550 conjugated

$570
PB9817-Dylight594

100 μg Dylight594 conjugated

$570
PB9817-FITC

100 μg FITC conjugated

$570
PB9817-HRP

100 μg HRP conjugated

$570
PB9817-APC

100 μg APC conjugated

$670
PB9817-PE

100 μg PE conjugated

$670
PB9817-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9817
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.