Anti-TrkA/NTRK1 Antibody Picoband™

TrkA antibody

Boster Bio Anti-TrkA/NTRK1 Antibody Picoband™ catalog # A00706. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A00706
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Product Name

Anti-TrkA/NTRK1 Antibody Picoband™

View all TrkA Antibodies

SKU/Catalog Number

A00706

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-TrkA/NTRK1 Antibody Picoband™ catalog # A00706. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-TrkA/NTRK1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00706)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human TrkA, which shares 90.2% amino acid (aa) sequence identity with both mouse and rat TrkA.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A00706 is reactive to NTRK1 in Human, Mouse, Rat

Applications

A00706 is guaranteed for WB Boster Guarantee

Observed Molecular Weight

150 kDa

Calculated molecular weight

87.497kDa

Background of TrkA

Neurotrophic tyrosine kinase receptor type 1, also called Trk-A, is a protein that in humans is encoded by the NTRK1 gene. The NTKR1 gene encodes the neurotrophic tyrosine kinase-1 receptor and belongs to a family of nerve growth factor receptors whose ligands include neurotrophins. This gene is mapped to 1q23.1. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. The presence of this kinase leads to cell differentiation and may play a role in specifying sensory neuron subtypes. Mutations in this gene have been associated with congenital insensitivity to pain, anhidrosis, self-mutilating behavior, mental retardation and cancer.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot,0.1-0.5μg/ml

Validation Images & Assay Conditions

Gene/Protein Information For NTRK1 (Source: Uniprot.org, NCBI)

Gene Name

NTRK1

Full Name

High affinity nerve growth factor receptor

Weight

87.497kDa

Superfamily

protein kinase superfamily

Alternative Names

DKFZp781I14186; EC 2.7.10; EC 2.7.10.1; MTChigh affinity nerve growth factor receptor; Neurotrophic tyrosine kinase receptor type 1; neurotrophic tyrosine kinase, receptor, type 1; NTRK1; NTRK-1; p140-TrkA; TRK1-transforming tyrosine kinase protein; TrkA; Trk-A; TRKAOncogene TRK; TRKTRK1; tyrosine kinase receptor A NTRK1 MTC, TRK, TRK1, TRKA, Trk-A, p140-TrkA neurotrophic receptor tyrosine kinase 1 high affinity nerve growth factor receptor|Oncogene TRK|TRK1-transforming tyrosine kinase protein|gp140trk|neurotrophic tyrosine kinase, receptor, type 1|tropomyosin-related kinase A|tyrosine kinase receptor A

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on NTRK1, check out the NTRK1 Infographic

NTRK1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NTRK1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A00706

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-TrkA/NTRK1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-TrkA/NTRK1 Antibody Picoband™

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

15 Customer Q&As for Anti-TrkA/NTRK1 Antibody Picoband™

Question

My lab would like using your anti-TrkA/NTRK1 antibody for signalling to p38 via rit and rin studies. Has this antibody been tested with western blotting on hela whole cell lysates? We would like to see some validation images before ordering.

T. Krishna

Verified customer

Asked: 2020-04-01

Answer

We appreciate your inquiry. This A00706 anti-TrkA/NTRK1 antibody is tested on human hela, hela whole cell lysates. It is guaranteed to work for WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2020-04-01

Question

My lab would like to test anti-TrkA/NTRK1 antibody A00706 on human adenohypophysis for research purposes, then I may be interested in using anti-TrkA/NTRK1 antibody A00706 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2020-02-17

Answer

The products we sell, including anti-TrkA/NTRK1 antibody A00706, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2020-02-17

Question

We are currently using anti-TrkA/NTRK1 antibody A00706 for mouse tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on dog tissues as well?

B. Johnson

Verified customer

Asked: 2020-02-05

Answer

The anti-TrkA/NTRK1 antibody (A00706) has not been tested for cross reactivity specifically with dog tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-02-05

Question

Please see the WB image, lot number and protocol we used for adenohypophysis using anti-TrkA/NTRK1 antibody A00706. Please let me know if you require anything else.

S. Johnson

Verified customer

Asked: 2020-01-15

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-01-15

Question

Is this A00706 anti-TrkA/NTRK1 antibody reactive to the isotypes of NTRK1?

Verified Customer

Verified customer

Asked: 2020-01-09

Answer

The immunogen of A00706 anti-TrkA/NTRK1 antibody is A synthetic peptide corresponding to a sequence of human TrkA (EVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVL). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-01-09

Question

We have observed staining in human colon. Are there any suggestions? Is anti-TrkA/NTRK1 antibody supposed to stain colon positively?

Verified Customer

Verified customer

Asked: 2019-12-03

Answer

From literature colon does express NTRK1. From Uniprot.org, NTRK1 is expressed in adenohypophysis, colon, brain, uterus, peripheral blood, among other tissues. Regarding which tissues have NTRK1 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 15489334, 7823156, 9290260
Colon, Pubmed ID: 2927393
Peripheral blood, Pubmed ID: 10861667, 10982191
Uterus, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2019-12-03

Question

I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for adenohypophysis using anti-TrkA/NTRK1 antibody A00706. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-11-25

Answer

Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-11-25

Question

I have a question about product A00706, anti-TrkA/NTRK1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-10-02

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00706 anti-TrkA/NTRK1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-10-02

Question

Does anti-TrkA/NTRK1 antibody A00706 work for WB with adenohypophysis?

Verified Customer

Verified customer

Asked: 2019-09-16

Answer

According to the expression profile of adenohypophysis, NTRK1 is highly expressed in adenohypophysis. So, it is likely that anti-TrkA/NTRK1 antibody A00706 will work for WB with adenohypophysis.

Boster Scientific Support

Answered: 2019-09-16

Question

I see that the anti-TrkA/NTRK1 antibody A00706 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-03-11

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-03-11

Question

Is there a BSA free version of anti-TrkA/NTRK1 antibody A00706 available?

Verified Customer

Verified customer

Asked: 2018-08-01

Answer

Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-TrkA/NTRK1 antibody A00706 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2018-08-01

Question

I was wanting to use your anti-TrkA/NTRK1 antibody for WB for human adenohypophysis on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human adenohypophysis identification?

Verified Customer

Verified customer

Asked: 2018-05-17

Answer

It shows on the product datasheet, A00706 anti-TrkA/NTRK1 antibody has been tested for WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human adenohypophysis in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2018-05-17

Question

Is a blocking peptide available for product anti-TrkA/NTRK1 antibody (A00706)?

Verified Customer

Verified customer

Asked: 2018-01-15

Answer

We do provide the blocking peptide for product anti-TrkA/NTRK1 antibody (A00706). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2018-01-15

Question

Our team were satisfied with the WB result of your anti-TrkA/NTRK1 antibody. However we have been able to see positive staining in uterus cell membrane using this antibody. Is that expected? Could you tell me where is NTRK1 supposed to be expressed?

Z. Baker

Verified customer

Asked: 2013-03-11

Answer

From what I have seen in literature, uterus does express NTRK1. Generally NTRK1 expresses in cell membrane. Regarding which tissues have NTRK1 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 15489334, 7823156, 9290260
Colon, Pubmed ID: 2927393
Peripheral blood, Pubmed ID: 10861667, 10982191
Uterus, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2013-03-11

Question

Would A00706 anti-TrkA/NTRK1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

P. Patel

Verified customer

Asked: 2013-02-21

Answer

As indicated on the product datasheet, A00706 anti-TrkA/NTRK1 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2013-02-21

Order DetailsPrice
A00706

100μg

$370
A00706-10ug

10μg sample (liquid)

$99
A00706-Biotin

100 μg Biotin conjugated

$570
A00706-Cy3

100 μg Cy3 conjugated

$570
A00706-Dylight488

100 μg Dylight488 conjugated

$570
A00706-Dylight550

100 μg Dylight550 conjugated

$570
A00706-Dylight594

100 μg Dylight594 conjugated

$570
A00706-FITC

100 μg FITC conjugated

$570
A00706-HRP

100 μg HRP conjugated

$570
A00706-APC

100 μg APC conjugated

$670
A00706-PE

100 μg PE conjugated

$670
A00706-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A00706
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.