ATP5F1E (NM_006886) Human Recombinant Protein

ATP5F1E protein,

Recombinant protein of human ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit (ATP5E), nuclear gene encoding mitochondrial protein

Product Info Summary

SKU: PROTP56381
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

ATP5F1E (NM_006886) Human Recombinant Protein

View all ATP5F1E recombinant proteins

SKU/Catalog Number

PROTP56381

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit (ATP5E), nuclear gene encoding mitochondrial protein

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

ATP5F1E (NM_006886) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP56381)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

5.78kDa

Amino Acid Sequence

MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For ATP5F1E (Source: Uniprot.org, NCBI)

Gene Name

ATP5F1E

Full Name

ATP synthase subunit epsilon, mitochondrial

Weight

5.78kDa

Superfamily

eukaryotic ATPase epsilon family

Alternative Names

ATP synthase subunit epsilon, mitochondrial ATP5F1E ATP5E, ATPE, MC5DN3 ATP synthase F1 subunit epsilon ATP synthase subunit epsilon, mitochondrial|ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit|F(0)F(1)-ATPase|H(+)-transporting two-sector ATPase|mitochondrial ATP synthase epsilon chain|mitochondrial ATPase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ATP5F1E, check out the ATP5F1E Infographic

ATP5F1E infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ATP5F1E: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP56381

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ATP5F1E (NM_006886) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review ATP5F1E (NM_006886) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ATP5F1E (NM_006886) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP56381
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.